SecReT4
Protein ID: 121605397
T4SS name [ID]Trb [261]
Gene symbol-
Locus tagPnap_2501
StrainPolaromonas naphthalenivorans CJ2
Repliconchromosome [GenBank: NC_008781] [Browse all T4SS(s) in this replicon]
Location [Strand]2635951..2636292 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDA1VQ77
KEGG IDpna:Pnap_2501
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.6e-18, Aligned region: 9..104
Protein Sequence: 113 a.a.     [Download]
>gi|121605397|ref|YP_982726.1| conjugal transfer protein TrbC [Polaromonas naphthalenivorans CJ2]
MHFQTTKPIKSLKKLVTPVISGMAALVSQVAHAGPALPWDGPITTVVNNLTGPVATGISTVAFLAAGAAL
IFGGDDLGGIAKKLLYVVLGVALIVFGANFLSMIGLVNSGALI
 
Nucleotide Sequence: 342 bp     [Download]
>gi|121602919|ref|NC_008781.1|:2635951-2636292 Polaromonas naphthalenivorans CJ2 chromosome, complete genome
GTGCATTTCCAAACAACCAAGCCTATCAAATCACTCAAAAAGCTGGTCACGCCCGTCATCTCGGGCATGG
CCGCACTGGTATCCCAGGTGGCCCACGCTGGCCCAGCCCTGCCCTGGGACGGCCCGATCACCACGGTGGT
CAACAACCTGACTGGGCCGGTGGCCACCGGCATTTCGACCGTGGCCTTCCTGGCAGCAGGCGCGGCACTG
ATTTTTGGTGGTGACGACTTGGGCGGAATTGCGAAGAAACTTTTGTACGTGGTGCTCGGTGTGGCGCTGA
TCGTCTTTGGTGCCAACTTCCTGAGCATGATCGGTCTGGTCAACAGCGGCGCCTTGATCTGA
 Primer design