SecReT4
Protein ID: 121605398
T4SS name [ID]Trb [261]
Gene symbol-
Locus tagPnap_2502
StrainPolaromonas naphthalenivorans CJ2
Repliconchromosome [GenBank: NC_008781] [Browse all T4SS(s) in this replicon]
Location [Strand]2636319..2636642 [+]
Productconjugal transfer TrbD family protein
Component typeTrbD
UniProt IDA1VQ78
KEGG IDpna:Pnap_2502
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 7.1e-22, Aligned region: 1..94
Protein Sequence: 107 a.a.     [Download]
>gi|121605398|ref|YP_982727.1| conjugal transfer TrbD family protein [Polaromonas naphthalenivorans CJ2]
MADQSKDSGADFSVPLHQSMLRPMLLLGAERELILALGIVAGVFIVSLFQLWAAIFGLILWAVGAWVLTR
AANFDPQLSKTFARSLQYRKLYKSAATPFASPRKFGG
 
Nucleotide Sequence: 324 bp     [Download]
>gi|121602919|ref|NC_008781.1|:2636319-2636642 Polaromonas naphthalenivorans CJ2 chromosome, complete genome
ATGGCTGATCAAAGCAAAGATAGCGGCGCTGACTTTTCAGTACCGTTGCATCAATCCATGCTCAGGCCCA
TGCTGCTGCTGGGCGCTGAGCGAGAGCTGATCCTGGCACTGGGCATCGTGGCCGGTGTGTTCATTGTTTC
CTTGTTTCAACTCTGGGCCGCCATTTTTGGTCTGATTTTGTGGGCCGTCGGCGCATGGGTGCTGACTCGC
GCGGCCAACTTTGACCCCCAACTCTCCAAGACCTTTGCTCGCAGTTTGCAATACCGCAAGCTGTACAAGA
GTGCCGCAACACCGTTTGCGTCGCCGCGCAAATTCGGAGGCTGA
 Primer design