SecReT4
Protein ID: 121605399
T4SS name [ID]Trb [261]
Gene symbol-
Locus tagPnap_2503
StrainPolaromonas naphthalenivorans CJ2
Repliconchromosome [GenBank: NC_008781] [Browse all T4SS(s) in this replicon]
Location [Strand]2636646..2639090 [+]
ProductCagE, TrbE, VirB component of type IV transporter system
Component typeTrbE
UniProt IDA1VQ79
KEGG IDpna:Pnap_2503
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 5.6e-39, Aligned region: 453..727
CagE_TrbE_VirB [PF03135], Evalue: 7e-19, Aligned region: 184..395
AAA_22 [PF13401], Evalue: 2.8e-06, Aligned region: 453..495
DUF87 [PF01935], Evalue: 1.1e-05, Aligned region: 453..488
Protein Sequence: 814 a.a.     [Download]
>gi|121605399|ref|YP_982728.1| CagE, TrbE, VirB component of type IV transporter system [Polaromonas naphthalenivorans CJ2]
MLLKEFRSQAQGLPDLLPWAALIDNGVVLTKSGGLLAGFEFRGPDLDSATKEELAAVSARINAALALDDG
WCLHVDAVRRQSPGYPLDGAFPDRTTRLLDDCRRLAHEGDWAGFQSDYTLVLCWHPDRDAAAKAEMLFVD
GAQKTGVAERSLTRFKTVLAEIESRLAGTLKIRRLVDTVDTETGSVESQLLAHLASCVALAPRASFVMGT
VPMYLDAVLGQHDFVTGFEPRIDDKTAICIAVTGFPGASFPGILDFLSRLPVEYRWSNRFIFMPVREADK
ALGNYRSKWAQKRLSLMNLMRSSQGGGVTHVNADADDMAADAVAAMAEASSGLVRFGFYTSVILLSSANL
QQLRDAAQYVTKMIANAGFSARVESVNAVEAYLGSMPGNLYANVRRPLVNTLNLAHLLPLTAIWAGPDAH
PCPFYPEHSAPLLQAKTDGATPYRLCLHAGDLGHTAIIGPTGSGKSTLLATLVAQHFRYPGAQAFVFDKG
YSMFPLVAAAGGQHYDIAGESDNITFCPLGQIDNELERTWAAEWLESLAELQGVAMSPELRKELFRAVNQ
LAASTDCAEQRTLSNFLLTLQDNRLREALEYYSLRGSAGRLLDAESDGLQADIFQVFELEHLMARGEKIV
LPVLAYLFHRLEQRFHGQPTLLVLDEAWIMLGHPAFRAKIREWLKVLRKSNVAVIFATQSLSDLSGSGIA
DVIFESCPSKILLPNPQAQTEALCGLYQAIGLNRRQIQIVSNAIPKRQYYHLHPDGSRVFELGLTPPEMA
FVGASGREDLARIRHLQKLDALTWPSAWLRERGQFDAARLWDSY
 
Nucleotide Sequence: 2445 bp     [Download]
>gi|121602919|ref|NC_008781.1|:2636646-2639090 Polaromonas naphthalenivorans CJ2 chromosome, complete genome
ATGCTCTTGAAAGAATTTCGCAGCCAGGCCCAAGGCCTGCCGGATCTGTTGCCCTGGGCGGCGCTGATCG
ACAACGGCGTGGTACTCACAAAATCTGGTGGCCTGCTGGCGGGTTTTGAATTTCGCGGCCCGGATCTGGA
CAGTGCCACCAAAGAGGAACTGGCGGCCGTGTCGGCTCGGATCAATGCGGCCCTGGCTCTTGATGACGGC
TGGTGCTTGCATGTGGATGCCGTGCGCCGTCAATCCCCTGGTTACCCTTTGGACGGCGCTTTTCCGGACC
GTACCACCCGACTGCTGGACGATTGCCGCCGTCTCGCCCATGAAGGCGATTGGGCTGGCTTTCAAAGTGA
CTACACGCTGGTCTTGTGCTGGCATCCGGACCGTGATGCTGCGGCAAAAGCCGAGATGCTGTTTGTGGAC
GGGGCTCAAAAGACTGGAGTGGCAGAGCGCAGTTTGACTCGCTTCAAAACTGTTCTGGCTGAAATTGAAT
CGCGGCTGGCAGGAACGCTAAAGATCCGTCGCCTGGTGGACACTGTCGACACTGAAACCGGATCGGTTGA
GAGTCAGCTTCTGGCGCATTTGGCTTCTTGTGTCGCTCTGGCACCACGCGCCAGTTTTGTCATGGGCACG
GTGCCAATGTACCTTGACGCGGTACTAGGCCAACACGACTTTGTGACGGGATTCGAGCCCCGGATTGACG
ACAAAACAGCTATTTGCATCGCCGTGACGGGCTTTCCTGGCGCCAGTTTCCCCGGCATTCTGGACTTCTT
GTCACGCTTGCCGGTGGAATACCGCTGGTCAAATCGTTTCATTTTCATGCCGGTGCGTGAAGCGGACAAG
GCCCTTGGCAACTACCGTTCAAAGTGGGCGCAAAAGCGGCTGTCACTGATGAACTTGATGCGCTCAAGCC
AGGGTGGCGGCGTCACCCACGTGAATGCGGATGCAGACGATATGGCTGCGGATGCGGTCGCCGCCATGGC
TGAGGCCAGCAGCGGCCTGGTGCGATTTGGCTTTTACACCAGCGTTATCCTGCTCTCCAGCGCAAACCTC
CAACAATTGCGTGATGCCGCGCAATACGTAACCAAGATGATCGCCAATGCCGGGTTTTCAGCTCGGGTCG
AATCCGTCAATGCGGTGGAAGCTTATCTGGGAAGCATGCCTGGCAATCTGTATGCCAATGTGCGCCGCCC
ACTGGTCAACACCTTGAACCTGGCGCACTTACTGCCCCTCACGGCAATTTGGGCCGGTCCGGATGCTCAC
CCGTGTCCCTTTTATCCTGAGCATTCGGCGCCGCTGTTGCAGGCAAAAACTGATGGTGCAACACCTTACC
GGCTTTGTCTGCACGCGGGCGATCTGGGTCACACGGCCATCATCGGACCGACTGGATCGGGCAAGTCCAC
TCTGTTGGCAACACTGGTAGCGCAGCATTTCCGCTATCCGGGCGCGCAAGCCTTTGTCTTTGACAAGGGC
TATTCCATGTTCCCCTTGGTGGCTGCTGCCGGTGGTCAGCATTACGACATTGCAGGTGAATCGGACAACA
TCACGTTTTGCCCCTTGGGACAAATTGACAATGAACTGGAGCGCACCTGGGCGGCTGAATGGCTTGAAAG
CCTGGCAGAACTGCAAGGTGTGGCCATGTCACCAGAACTGCGCAAAGAGCTCTTTCGCGCCGTCAACCAG
TTGGCGGCCTCCACAGACTGCGCGGAGCAACGCACGCTGTCAAACTTTCTGTTGACCCTGCAGGACAACC
GTCTGCGTGAAGCGCTGGAATACTACTCGCTGCGTGGATCAGCGGGGCGGTTGCTGGATGCCGAAAGCGA
TGGACTGCAGGCGGACATCTTCCAGGTCTTCGAGCTTGAACACCTGATGGCTCGCGGCGAAAAGATCGTG
CTGCCCGTTCTGGCTTACCTGTTTCACCGGCTTGAGCAGCGTTTTCACGGTCAACCTACCTTGTTGGTGC
TTGATGAGGCCTGGATCATGCTGGGGCACCCTGCATTCAGGGCCAAGATTCGCGAATGGCTGAAGGTGCT
GCGCAAATCGAACGTGGCCGTCATTTTTGCGACCCAGTCCCTGAGCGATCTGTCTGGCAGCGGGATTGCC
GATGTGATTTTCGAGTCTTGTCCCTCAAAAATTCTGTTGCCCAACCCGCAAGCGCAAACCGAAGCCTTGT
GCGGGCTGTATCAAGCGATTGGACTCAACCGTCGGCAAATCCAGATCGTCAGCAATGCCATACCTAAGCG
CCAGTATTACCACCTGCACCCGGACGGCTCCCGCGTTTTTGAATTGGGACTGACTCCGCCGGAAATGGCC
TTTGTTGGGGCAAGTGGACGCGAGGATTTGGCGCGGATTCGTCATCTGCAAAAGCTCGATGCGCTTACCT
GGCCGTCTGCCTGGTTGCGGGAACGCGGTCAGTTCGATGCCGCCCGTTTATGGGATAGCTATTGA
 Primer design