SecReT4
Protein ID: 121605400
T4SS name [ID]Trb [261]
Gene symbol-
Locus tagPnap_2504
StrainPolaromonas naphthalenivorans CJ2
Repliconchromosome [GenBank: NC_008781] [Browse all T4SS(s) in this replicon]
Location [Strand]2639249..2639950 [+]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDA1VQ80
KEGG IDpna:Pnap_2504
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 233 a.a.     [Download]
>gi|121605400|ref|YP_982729.1| conjugal transfer protein TrbJ [Polaromonas naphthalenivorans CJ2]
MKPKKLLSSAAVAAAFAFALIPSAHAGGGGFVGAMEATQWLNNAELVNVYSSNLEQLQQQIQMYQNMYQN
TLGIPIQAWSGIAARLTSLVSTIQNTQGIVNATVNSITDMQTTYGNGNLLSNQQQNLVNWNKGLNNQIGA
ALQQLGLNANNFSTTQSALQQIQLASQTAAGRLQAIQAGNQIAGMMINETQALHGTIIAAEQARLNAIAK
QENEKYQDELLYRNFFRNHSGQY
 
Nucleotide Sequence: 702 bp     [Download]
>gi|121602919|ref|NC_008781.1|:2639249-2639950 Polaromonas naphthalenivorans CJ2 chromosome, complete genome
ATGAAGCCCAAGAAGCTGCTTTCCAGCGCCGCAGTGGCGGCTGCCTTTGCTTTTGCGTTGATACCATCCG
CTCACGCCGGTGGCGGTGGGTTTGTGGGTGCCATGGAAGCCACCCAGTGGCTGAACAACGCCGAGCTGGT
CAATGTCTATTCAAGCAATCTGGAACAGCTGCAGCAGCAAATCCAGATGTACCAGAACATGTACCAGAAC
ACGCTCGGCATTCCGATTCAGGCGTGGAGCGGCATTGCGGCGCGTTTGACATCGTTGGTCAGCACGATTC
AAAACACGCAAGGCATTGTGAACGCCACTGTCAATTCCATCACCGACATGCAAACAACCTACGGCAACGG
AAATTTGCTTTCGAACCAACAGCAAAATCTGGTGAATTGGAACAAGGGCTTGAACAACCAGATTGGGGCG
GCTTTGCAGCAATTGGGCTTGAACGCAAACAATTTTTCGACAACGCAAAGTGCTTTGCAGCAAATTCAGT
TAGCATCCCAGACTGCGGCGGGCCGGTTGCAAGCAATTCAGGCTGGCAATCAAATTGCCGGCATGATGAT
CAATGAAACCCAAGCACTGCACGGCACCATCATTGCGGCGGAACAGGCCCGACTGAATGCCATCGCCAAA
CAGGAAAACGAAAAGTACCAAGACGAGCTTTTGTACCGCAACTTCTTTCGTAACCATTCCGGCCAATACT
GA
 Primer design