SecReT4
Protein ID: 121605401
T4SS name [ID]Trb [261]
Gene symbol-
Locus tagPnap_2505
StrainPolaromonas naphthalenivorans CJ2
Repliconchromosome [GenBank: NC_008781] [Browse all T4SS(s) in this replicon]
Location [Strand]2639965..2641590 [+]
ProductType IV secretory pathway TrbL components-like protein
Component typeTrbL
UniProt IDA1VQ81
KEGG IDpna:Pnap_2505
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 4.6e-20, Aligned region: 54..293
Protein Sequence: 541 a.a.     [Download]
>gi|121605401|ref|YP_982730.1| Type IV secretory pathway TrbL components-like protein [Polaromonas naphthalenivorans CJ2]
MRVAIFLLLCGITPWANAAGMMDTLVSQVQGASGGWMTTALGYATNLFFGLAALEFAWSAIQLTLKKSEL
SEIMVGTLFKVMSLSFFAMVLIKAPEWIPAIINSFKAAGAGVGGTSVLSPSAVFDQGLQVAASLMQFSND
AAPSTGSMIINTLTNSGQGLGKFMLSSIIIGVASVFIILGYGLIAVQLLITLVESYLIIGGGALMLGFSG
SRWTHNLSEKYFGYAISIGVKLFTIYLIIGFGDSFTQALKDTIAAAYAAHPEGPSFGDYLGVGGASLFYG
VTGYMAPGLAGSMLNGTVAMSLQSAGTAAGMVGGAPVAAGLAASAAGARALGLAGGAMGALMPVQRAAGA
IGGSSAGVGFGGGISGMVNPVNPFQPSANASSGGQGVPGGLGAAVQSGMAGKSGGGTGSHLGASSPSPSP
PPSDSPVGWQGLNAGSQSFGQTQAPGFVDARFDPFASPRDGGSGKSHPTSNETGGMPANSFDAKSAQQRF
EADYKQEPSGVADKLNSFSKRLQYAADRRKPHWVSDGHLGHAPGLRMGLDS
 
Nucleotide Sequence: 1626 bp     [Download]
>gi|121602919|ref|NC_008781.1|:2639965-2641590 Polaromonas naphthalenivorans CJ2 chromosome, complete genome
ATGCGGGTCGCCATTTTTCTGCTGCTGTGCGGCATCACGCCATGGGCGAATGCCGCTGGCATGATGGACA
CGCTGGTGAGTCAGGTTCAAGGGGCATCCGGCGGCTGGATGACGACTGCTTTGGGTTACGCCACCAATTT
GTTCTTTGGCTTGGCTGCCCTTGAATTCGCCTGGTCGGCGATTCAGCTCACGCTCAAAAAGTCAGAGCTT
TCGGAAATCATGGTGGGGACCTTGTTCAAGGTCATGTCCCTGTCATTTTTTGCCATGGTGCTGATCAAGG
CGCCCGAGTGGATTCCTGCCATCATCAATTCCTTCAAGGCGGCCGGTGCCGGTGTGGGTGGGACTTCGGT
TTTGTCGCCATCGGCGGTGTTTGATCAAGGCTTGCAAGTAGCCGCCAGTCTGATGCAGTTCTCCAATGAT
GCCGCGCCCAGCACGGGCAGCATGATCATCAACACCTTGACCAATTCCGGTCAGGGTCTTGGCAAATTCA
TGTTGAGCTCCATCATCATTGGCGTTGCCTCTGTTTTCATCATTCTTGGCTACGGTCTGATTGCCGTCCA
ACTGCTCATTACGTTGGTTGAGTCGTATTTGATCATTGGCGGTGGTGCCTTGATGCTCGGGTTTTCGGGC
TCACGCTGGACGCACAATTTGTCAGAAAAGTACTTTGGCTATGCGATTTCCATTGGCGTCAAACTGTTCA
CCATCTATTTGATCATTGGCTTTGGTGACAGCTTCACCCAAGCCCTGAAAGACACCATTGCAGCTGCCTA
CGCGGCGCACCCCGAAGGCCCCAGTTTTGGTGACTATTTGGGCGTGGGGGGCGCGTCGTTGTTCTATGGA
GTCACTGGCTACATGGCACCGGGCCTGGCGGGGTCGATGCTCAATGGCACGGTGGCCATGTCTCTGCAAA
GCGCTGGCACTGCGGCTGGCATGGTGGGTGGCGCGCCGGTGGCGGCGGGACTTGCTGCAAGTGCGGCTGG
TGCGCGCGCCTTGGGGCTTGCGGGCGGTGCCATGGGTGCGTTGATGCCCGTTCAAAGAGCTGCGGGTGCC
ATTGGTGGCTCTTCTGCTGGCGTCGGATTTGGTGGTGGCATCAGTGGCATGGTCAACCCTGTCAACCCTT
TTCAACCCAGTGCGAACGCGAGCAGCGGTGGCCAGGGCGTACCCGGTGGTTTGGGCGCTGCAGTCCAGAG
CGGCATGGCTGGCAAGTCGGGTGGCGGCACTGGCAGTCACCTCGGTGCATCTTCACCCTCCCCCTCGCCG
CCTCCTTCTGACAGTCCTGTGGGTTGGCAAGGCTTGAACGCGGGTAGTCAAAGTTTTGGCCAGACCCAAG
CTCCCGGTTTTGTTGATGCGCGTTTTGATCCATTTGCCAGTCCACGTGATGGCGGCTCCGGCAAAAGCCA
CCCAACCAGCAACGAAACCGGTGGCATGCCTGCCAATTCATTCGATGCAAAGTCTGCCCAACAACGATTT
GAGGCTGACTACAAGCAAGAACCAAGTGGCGTGGCAGACAAGCTCAACAGTTTTTCAAAGCGTTTGCAAT
ACGCTGCGGATCGCAGGAAGCCGCATTGGGTGAGTGATGGTCATCTGGGTCACGCGCCAGGCTTGCGCAT
GGGGCTCGATTCTTGA
 Primer design