SecReT4
Protein ID: 121605405
T4SS name [ID]Trb [261]
Gene symbol-
Locus tagPnap_2509
StrainPolaromonas naphthalenivorans CJ2
Repliconchromosome [GenBank: NC_008781] [Browse all T4SS(s) in this replicon]
Location [Strand]2645366..2646019 [+]
Productconjugal transfer protein
Component typeTrbF
UniProt IDA1VQ85
KEGG IDpna:Pnap_2509
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.7e-48, Aligned region: 10..215
Protein Sequence: 217 a.a.     [Download]
>gi|121605405|ref|YP_982734.1| conjugal transfer protein [Polaromonas naphthalenivorans CJ2]
MSKQNPYLNARREWDERYGGLISRARNWQLIAAGSLAVAVVAVVGIAFIGSQSKIQPFVVVTDQLGSPVA
VARPAPVAKSDFDKRLMVAQLAAFIKDVRSMLPDAVAQQVTLNRVYAMAGRDVAGFLNDFFKDNSPFSVD
GSVTRVDISSVIPQGGEAYQVSWVETKARPGATSVAEHWKAVVTVGVDAKLAENPKVALWNPFGIYVKSI
SWTKEAL
 
Nucleotide Sequence: 654 bp     [Download]
>gi|121602919|ref|NC_008781.1|:2645366-2646019 Polaromonas naphthalenivorans CJ2 chromosome, complete genome
ATGTCAAAACAAAATCCATACCTCAACGCCCGCCGGGAGTGGGATGAGCGCTACGGAGGGTTGATCTCAC
GCGCGCGCAATTGGCAACTGATTGCGGCTGGCTCCTTGGCTGTCGCGGTTGTGGCTGTGGTGGGCATTGC
TTTCATCGGGTCCCAATCAAAGATTCAACCGTTTGTGGTTGTCACCGATCAACTCGGCTCTCCGGTTGCT
GTGGCCCGTCCTGCGCCGGTTGCAAAAAGTGATTTCGACAAGCGGTTAATGGTGGCCCAACTGGCCGCCT
TCATCAAAGACGTCCGCTCCATGTTGCCCGATGCTGTTGCCCAACAGGTCACGCTCAACCGGGTGTATGC
CATGGCGGGGCGCGACGTGGCCGGATTCTTGAATGACTTCTTCAAGGACAACTCGCCTTTCTCGGTCGAT
GGTTCGGTCACCCGCGTGGACATTTCGTCGGTCATTCCCCAAGGCGGTGAAGCCTACCAAGTGTCCTGGG
TGGAAACCAAAGCCAGGCCCGGCGCGACGTCTGTGGCAGAACACTGGAAAGCCGTCGTCACGGTCGGGGT
TGACGCCAAGCTGGCAGAAAACCCCAAAGTCGCGCTCTGGAATCCATTTGGCATTTACGTCAAGTCCATC
TCCTGGACCAAAGAAGCTCTGTAA
 Primer design