SecReT4
Protein ID: 121605406
T4SS name [ID]Trb [261]
Gene symbol-
Locus tagPnap_2510
StrainPolaromonas naphthalenivorans CJ2
Repliconchromosome [GenBank: NC_008781] [Browse all T4SS(s) in this replicon]
Location [Strand]2646379..2647161 [+]
Productconjugal transfer protein TrbG/VirB9/CagX
Component typeTrbG
UniProt IDA1VQ86
KEGG IDpna:Pnap_2510
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3.6e-48, Aligned region: 11..246
Protein Sequence: 260 a.a.     [Download]
>gi|121605406|ref|YP_982735.1| conjugal transfer protein TrbG/VirB9/CagX [Polaromonas naphthalenivorans CJ2]
MADALVGAGGVVEYPYGYSRPTITCAPLHVCSVALQDGEAATSVSIGDTVRWLLQTATAGAKPVMMIKPT
QAGLSTNLVVTTDKGRIYYMHLVSSKTEYVPMVSWYDPAAMTRDLSAEAQTSARQKAEFEATMVATKIAA
EQAKAQRVVADKSVGKLDPTTLDFGYTCTGEAAFKPARVFANDTHTFIQLPPGASASDAPAVFNVSNNET
ELLNSRLVNGYYIIDGKPAKLSLVLGVGASAQTVKCQKSVPNSLFSWGTK
 
Nucleotide Sequence: 783 bp     [Download]
>gi|121602919|ref|NC_008781.1|:2646379-2647161 Polaromonas naphthalenivorans CJ2 chromosome, complete genome
GTGGCTGATGCGCTCGTCGGTGCCGGTGGCGTTGTCGAATATCCCTATGGATATTCACGTCCCACGATTA
CTTGCGCCCCCTTACACGTCTGCTCTGTAGCACTGCAAGATGGCGAGGCCGCGACCAGTGTGTCAATTGG
CGATACGGTGCGATGGTTATTACAGACCGCAACAGCCGGGGCAAAGCCGGTGATGATGATCAAACCGACA
CAGGCGGGCCTCTCAACGAACCTGGTTGTAACGACCGACAAGGGCCGCATTTATTACATGCACCTGGTGT
CGAGCAAAACCGAGTATGTGCCTATGGTGAGTTGGTATGACCCGGCTGCCATGACGCGCGACTTGAGCGC
CGAGGCGCAAACATCGGCACGGCAAAAGGCAGAATTTGAGGCAACGATGGTTGCCACCAAGATTGCCGCC
GAACAGGCCAAAGCCCAAAGGGTCGTGGCGGACAAGTCGGTTGGCAAGCTTGATCCAACGACGCTTGATT
TTGGCTACACCTGCACCGGTGAGGCGGCATTCAAACCTGCACGTGTCTTTGCCAATGACACGCACACATT
TATTCAATTGCCACCTGGTGCTTCGGCCAGTGATGCGCCGGCGGTGTTCAATGTCTCGAACAATGAAACC
GAGCTGCTGAATTCCAGGCTCGTAAATGGCTACTACATCATCGATGGCAAACCTGCCAAACTCAGTCTGG
TTCTGGGTGTGGGTGCCAGCGCCCAAACCGTCAAATGCCAAAAATCAGTGCCAAACAGTTTGTTTAGCTG
GGGCACCAAATGA
 Primer design