SecReT4
Protein ID: 121605407
T4SS name [ID]Trb [261]
Gene symbol-
Locus tagPnap_2511
StrainPolaromonas naphthalenivorans CJ2
Repliconchromosome [GenBank: NC_008781] [Browse all T4SS(s) in this replicon]
Location [Strand]2647158..2648630 [+]
Productconjugation TrbI family protein
Component typeTrbI
UniProt IDA1VQ87
KEGG IDpna:Pnap_2511
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1e-56, Aligned region: 303..486
Protein Sequence: 490 a.a.     [Download]
>gi|121605407|ref|YP_982736.1| conjugation TrbI family protein [Polaromonas naphthalenivorans CJ2]
MIFRFGKKSQTDDTADVEVAAIDGPGQPLEIHTPPPGTKRLSKKGQFLLLGGASTVASAILIGVMISGKS
GGNAESKKQLTASDAPGQAAPYKENAEDIQRRATVAAAAVGNQATLQITDGQQTGPLTSRSSNPKGSPGG
TQTASGGASPPSPAEAHRLWLQKRKYERIQGHIMASDSAETSDISKGGAALAAKSTAGGIMGVNADGEGV
GGGVNQKLSAANGRAANARASATAEAMRMANLPAGVAGISSNSGNLPATLAGGGSAGLDPAVAAQARNKA
FMKEAFDNGYLPELLKPKLGEFELTAGSVIPAVMLSGINSDLPGTIVAQTRQTVYATNDPDAVVIPQGSR
LIGRYSADVAYGQSRVLAAWDELILPNGSRISLHGMSAADGQGQSGIEDQVNNHFWKTWSSALLVSFLGV
AAQQSQPQNQGAFNTPSGSAQASAAAMNSLSDVSSKILQKSLNISPTLQVRPGMAFNVMVNRSIILPTYR
 
Nucleotide Sequence: 1473 bp     [Download]
>gi|121602919|ref|NC_008781.1|:2647158-2648630 Polaromonas naphthalenivorans CJ2 chromosome, complete genome
ATGATTTTCAGATTTGGCAAAAAGTCCCAGACTGACGATACAGCTGACGTTGAGGTGGCGGCCATTGATG
GCCCGGGTCAGCCGCTGGAAATTCATACGCCACCACCTGGCACCAAGCGACTGTCCAAGAAAGGGCAGTT
TTTACTCTTGGGCGGCGCGTCCACGGTGGCATCGGCAATTTTGATCGGCGTGATGATCAGCGGCAAAAGT
GGTGGCAATGCTGAGTCAAAAAAACAATTGACCGCCAGTGATGCGCCGGGTCAAGCGGCTCCGTACAAGG
AAAACGCTGAAGACATCCAGCGCAGAGCAACTGTTGCCGCTGCAGCGGTTGGCAATCAAGCCACTCTTCA
AATAACTGATGGCCAGCAAACGGGGCCATTGACAAGCCGCTCGTCAAATCCAAAAGGCAGTCCTGGGGGA
ACTCAAACTGCCAGTGGTGGTGCCTCACCGCCCTCGCCCGCTGAGGCGCACCGGTTGTGGCTGCAAAAGC
GCAAGTATGAGCGCATTCAGGGGCACATCATGGCTTCTGACTCAGCCGAAACCTCTGACATCAGCAAGGG
TGGTGCCGCGCTGGCTGCCAAATCGACGGCGGGAGGAATCATGGGCGTGAATGCTGATGGTGAGGGCGTG
GGTGGCGGTGTGAATCAAAAGCTCTCAGCCGCCAACGGGCGTGCTGCGAATGCGCGTGCGTCTGCCACGG
CTGAGGCCATGCGCATGGCGAATTTGCCAGCCGGGGTGGCAGGTATCAGCAGTAACTCAGGAAATTTACC
TGCCACTCTGGCCGGTGGCGGTTCCGCCGGTCTTGATCCTGCAGTGGCGGCCCAAGCGCGCAACAAGGCT
TTCATGAAAGAAGCATTTGACAACGGCTACTTGCCAGAATTGCTCAAACCCAAATTGGGGGAATTTGAAT
TGACGGCTGGCTCCGTCATCCCCGCGGTCATGCTGTCTGGCATCAATTCCGATCTGCCTGGAACCATCGT
GGCCCAAACCCGCCAAACTGTTTATGCCACCAATGACCCTGACGCTGTGGTGATCCCGCAGGGCTCGCGT
CTGATCGGCAGGTACTCTGCTGATGTCGCCTATGGTCAATCACGGGTGCTGGCGGCTTGGGATGAACTGA
TTTTGCCCAATGGCTCGCGGATTTCATTGCATGGCATGTCGGCGGCCGACGGTCAGGGTCAATCAGGCAT
TGAAGATCAGGTCAATAACCACTTCTGGAAAACCTGGTCGTCAGCTCTGTTGGTGTCCTTTTTGGGTGTT
GCCGCCCAACAGTCGCAGCCACAAAACCAGGGTGCATTCAACACCCCGTCCGGTTCGGCTCAAGCCTCTG
CTGCCGCCATGAATTCCTTGAGTGATGTCAGTTCGAAGATTTTGCAAAAAAGCTTGAACATTTCGCCCAC
TCTGCAAGTTCGCCCTGGCATGGCTTTCAACGTCATGGTCAACCGCTCGATCATCTTGCCGACCTACCGA
TGA
 Primer design