SecReT4
Protein ID: 121605425
T4SS name [ID]Trb [261]
Gene symbol-
Locus tagPnap_2530
StrainPolaromonas naphthalenivorans CJ2
Repliconchromosome [GenBank: NC_008781] [Browse all T4SS(s) in this replicon]
Location [Strand]2665222..2667207 [+]
ProductTRAG family protein
Component typeTraG
UniProt IDA1VQA5
KEGG IDpna:Pnap_2530
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 2e-112, Aligned region: 135..639
TraG-D_C [PF12696], Evalue: 5.2e-31, Aligned region: 488..608
TrwB_AAD_bind [PF10412], Evalue: 1.3e-24, Aligned region: 393..623
AAA_10 [PF12846], Evalue: 3.3e-08, Aligned region: 189..562
Protein Sequence: 661 a.a.     [Download]
>gi|121605425|ref|YP_982754.1| TRAG family protein [Polaromonas naphthalenivorans CJ2]
MTSSQRQQLYVIPHSHGDITRFVWVAFLIFGLVTALTFVLVTQYTAWQFRFHPTLGSPAAMLGQTRIYWP
WDVLIWIFRYFRPDSSPDVLSVIKTAQLMLASGAMTSIVFPVAYVFRRTRKLKDERNDLHGSAHWAVAEE
IEAAGILPTPANVGGVMLGAVDIPVKNSGFNPFSAKAKTVYLRHSGPEHILVFAPTRSGKGVGIVVPTLL
SWSESVLVHDIKGENWALTSGFRERVLKQRCLRFSPSETDSARFNPLSEIRLDDNLVKDVQNVSTMIVDP
DGKGLQDHWAKTGFDLMTGVIIFVLVSDELEDSQRNLSTVQAILSDGGPVRELAERLAADKDTDADEKTK
IAEGFRAVMEYIRDIGYERIGAGHCTDVELVAWKTASQAAQSFLNKASNEASGVLSTALSFLSLYRDPIV
AANTSASDFTIESLMQRRTSLYLVVPPSDKDRLKPLLRLVINQVVRRLTEKMEFDETGASRSRFPHKMLL
LIDEFPALGKLEIFEEALAFIAGYGLKALLITQDLSQLTKAYSRDESILSNCHIRIAFAPNKIETAELLS
KMSGASTVAHTQRNFSGSRLSVVLNNVSTNEQLSQRPLLTPDETMRLPPADELVFVAGHAPIYCQKIIYY
TDPALVKRQMLGAAKLIGNGMIDARVKSTRS
 
Nucleotide Sequence: 1986 bp     [Download]
>gi|121602919|ref|NC_008781.1|:2665222-2667207 Polaromonas naphthalenivorans CJ2 chromosome, complete genome
ATGACCAGCTCGCAGCGACAGCAGCTCTACGTCATCCCCCACAGTCATGGCGACATCACCCGCTTCGTGT
GGGTGGCCTTTCTGATCTTTGGTTTGGTCACCGCGCTGACCTTCGTGCTGGTCACACAGTACACCGCCTG
GCAGTTTCGTTTTCATCCGACACTCGGATCGCCTGCCGCGATGCTTGGCCAGACACGGATTTACTGGCCG
TGGGACGTCCTGATCTGGATATTTCGGTACTTCCGGCCAGACTCGTCACCCGATGTCCTGTCCGTCATCA
AGACAGCTCAGCTGATGCTGGCATCAGGCGCCATGACCTCCATTGTTTTCCCGGTGGCTTATGTGTTCCG
GCGAACCCGCAAGCTGAAAGACGAGCGCAACGACCTGCACGGTTCAGCCCATTGGGCCGTGGCAGAAGAA
ATCGAAGCGGCTGGGATTTTGCCAACACCGGCCAACGTTGGCGGTGTGATGCTGGGTGCCGTTGACATTC
CTGTCAAGAATTCTGGTTTCAACCCGTTTAGCGCAAAAGCCAAAACCGTGTATCTGCGCCATAGCGGTCC
GGAACACATTCTGGTGTTCGCTCCGACGCGTTCAGGCAAAGGTGTTGGTATCGTGGTGCCGACACTGCTG
TCCTGGTCAGAATCAGTGCTTGTGCATGACATCAAGGGAGAAAACTGGGCACTGACTTCTGGCTTTCGTG
AGAGGGTCTTGAAGCAACGGTGCCTGCGGTTTTCGCCATCAGAAACGGATTCGGCACGCTTCAATCCACT
GTCCGAAATTCGGCTTGACGACAACCTGGTGAAGGACGTGCAAAACGTATCGACCATGATTGTTGACCCC
GACGGGAAAGGTCTGCAGGACCATTGGGCCAAAACCGGCTTTGACCTCATGACCGGTGTCATCATTTTTG
TGCTGGTGTCCGATGAGCTGGAAGACTCCCAACGGAATTTGTCAACCGTACAGGCCATTTTGTCGGACGG
TGGACCGGTGCGCGAGCTGGCTGAGCGACTGGCTGCAGATAAAGACACCGATGCCGATGAAAAAACCAAA
ATTGCCGAGGGCTTCCGGGCGGTGATGGAATACATCCGGGACATCGGCTACGAAAGGATCGGTGCGGGTC
ACTGCACCGATGTGGAACTGGTCGCCTGGAAAACCGCCTCGCAAGCTGCCCAGTCGTTTTTGAACAAGGC
CTCCAACGAAGCCTCTGGCGTGCTGTCGACGGCCCTGTCGTTCCTGTCGCTGTACCGTGATCCGATTGTG
GCTGCCAACACCAGTGCCTCGGACTTCACGATCGAGTCGCTGATGCAGCGCAGGACAAGTCTGTACCTGG
TCGTGCCACCCTCAGACAAAGACCGCCTGAAGCCACTCTTGAGGCTTGTCATCAATCAGGTGGTTCGCCG
TTTGACCGAAAAAATGGAATTTGATGAAACCGGCGCTTCCAGGTCGCGGTTCCCGCACAAGATGCTGCTG
CTGATTGATGAATTTCCGGCGCTGGGTAAACTTGAAATTTTTGAGGAGGCCCTGGCGTTTATCGCTGGCT
ACGGGCTCAAGGCCTTGTTGATCACCCAAGACCTGTCCCAGTTGACCAAAGCCTACTCAAGAGACGAATC
TATCCTGTCGAATTGCCACATCCGGATTGCCTTCGCGCCCAACAAAATCGAGACGGCTGAGCTGCTCTCC
AAAATGAGCGGTGCCTCCACGGTTGCCCACACCCAAAGAAATTTCTCGGGCTCACGCTTGAGCGTGGTGC
TGAACAATGTCAGCACGAATGAACAACTGAGCCAGCGACCCTTACTGACACCGGATGAAACCATGCGCCT
CCCACCGGCCGATGAGCTGGTGTTTGTCGCTGGTCACGCGCCAATTTACTGCCAGAAAATCATCTATTAC
ACAGATCCAGCGCTGGTGAAAAGACAGATGCTGGGGGCCGCCAAACTGATCGGAAATGGAATGATTGACG
CGCGCGTCAAAAGCACTCGAAGCTGA
 Primer design