SecReT4
Protein ID: 121605426
T4SS name [ID]Trb [261]
Gene symbol-
Locus tagPnap_2531
StrainPolaromonas naphthalenivorans CJ2
Repliconchromosome [GenBank: NC_008781] [Browse all T4SS(s) in this replicon]
Location [Strand]2667227..2667751 [+]
Productconjugal transfer protein TraF
Component typeTraF
UniProt IDA1VQA6
KEGG IDpna:Pnap_2531
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 1.2e-30, Aligned region: 33..166
Protein Sequence: 174 a.a.     [Download]
>gi|121605426|ref|YP_982755.1| conjugal transfer protein TraF [Polaromonas naphthalenivorans CJ2]
MKAKQLNLVPLYVTLLAMSATAIFAIVAKSSGLVLNVTGSMPDLVYKLGLGEKGSLVSFCSPIPHPSIGH
GACPDGSMPLIKRVVGVAGDLVTATDAGIDINGQPVPNSRPLDLDTKESALPHLRGSFSLKQGDIWTAGE
HPNSFDSRYFGPVKFPRDDHHNRTRESSFRFADG
 
Nucleotide Sequence: 525 bp     [Download]
>gi|121602919|ref|NC_008781.1|:2667227-2667751 Polaromonas naphthalenivorans CJ2 chromosome, complete genome
ATGAAAGCCAAACAACTGAACCTCGTACCGCTTTATGTGACGCTACTTGCGATGTCAGCGACAGCGATTT
TTGCCATCGTCGCAAAGTCATCTGGCCTCGTTTTGAATGTCACTGGATCGATGCCTGACTTGGTCTACAA
ATTAGGCCTTGGCGAAAAGGGCAGCCTAGTCAGCTTTTGCTCGCCGATTCCGCATCCGTCCATCGGTCAC
GGCGCGTGCCCTGATGGCAGCATGCCCTTGATAAAGCGCGTGGTGGGCGTTGCTGGCGATCTCGTGACAG
CAACCGATGCCGGTATTGACATCAACGGGCAGCCAGTGCCGAATTCAAGGCCACTGGATCTGGACACCAA
GGAAAGCGCCCTTCCCCATCTGCGCGGATCGTTTAGCCTCAAACAAGGAGATATCTGGACTGCTGGTGAA
CACCCGAACAGCTTTGATTCACGGTATTTTGGGCCTGTGAAATTTCCAAGGGATGACCACCACAACAGGA
CACGCGAATCCTCGTTCAGATTTGCCGATGGGTGA
 Primer design