SecReT4
Protein ID: 121610622
T4SS name [ID]Trb [790]
Gene symbol-
Locus tagVeis_3696
StrainVerminephrobacter eiseniae EF01-2
Repliconchromosome [GenBank: NC_008786] [Browse all T4SS(s) in this replicon]
Location [Strand]4087935..4088753 [-]
Productconjugal transfer protein TrbG/VirB9/CagX
Component typeTrbG
UniProt IDA1WP54
KEGG IDvei:Veis_3696
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.4e-51, Aligned region: 36..271
Protein Sequence: 272 a.a.     [Download]
>gi|121610622|ref|YP_998429.1| conjugal transfer protein TrbG/VirB9/CagX [Verminephrobacter eiseniae EF01-2]
MKLRTFAITASVLAGSALAQAAPESEISVPIPGNLDPRIVTFAYTPDVVYQLPVTVGMHTHIPFTADEEL
SEPPSIGEKVRWRLEGNEKNIYIKALQPGVRTSLTLVTNKRTYQFELIATTKPNERIQKAQFTYPDEQAG
IQMAWRNKTERAAEQAAQIERHRKAQNLSDAPMDASQLAFYSVRTDNTQYQRMHVYSDGVKTWMRLPPGV
QDLPAVFMVDKDQRGREQLMPVNYTVADRENLRDRDVIIIDRTAALWMLRIGQSIEVRVARD
 
Nucleotide Sequence: 819 bp     [Download]
>gi|121607004|ref|NC_008786.1|:c4088753-4087935 Verminephrobacter eiseniae EF01-2 chromosome, complete genome
ATGAAACTGCGCACCTTCGCCATCACTGCATCTGTTCTGGCTGGCAGCGCCCTGGCGCAGGCCGCGCCCG
AGAGCGAAATCTCCGTGCCGATCCCCGGAAATCTCGATCCGCGCATCGTGACGTTCGCCTATACGCCCGA
TGTGGTCTATCAACTGCCGGTGACGGTGGGCATGCACACCCACATTCCTTTCACGGCCGATGAAGAGCTG
TCGGAGCCGCCCTCGATCGGCGAGAAGGTGCGCTGGCGGCTCGAAGGCAATGAGAAGAACATCTACATCA
AGGCGCTGCAGCCGGGGGTGCGCACCTCCCTGACGCTGGTCACCAACAAGCGGACATACCAGTTCGAGCT
GATCGCCACGACAAAGCCGAACGAGCGCATCCAGAAGGCGCAGTTCACCTACCCCGATGAGCAAGCCGGC
ATCCAGATGGCCTGGCGCAACAAGACCGAGCGTGCCGCCGAGCAAGCCGCGCAGATCGAGCGCCACCGCA
AGGCGCAGAACCTGTCGGACGCCCCCATGGACGCCAGCCAACTGGCGTTCTATTCGGTGCGCACGGACAA
CACGCAGTACCAGCGCATGCATGTCTATTCCGATGGCGTCAAGACCTGGATGCGGCTGCCCCCGGGAGTG
CAGGACCTTCCGGCGGTTTTCATGGTGGACAAGGACCAGCGCGGCCGTGAGCAACTGATGCCGGTGAACT
ACACGGTTGCCGATCGCGAAAACCTGCGCGACCGGGACGTGATCATCATCGACCGTACGGCAGCGCTGTG
GATGCTGCGCATCGGCCAGTCCATCGAGGTCCGTGTGGCACGCGATTGA
 Primer design