SecReT4
Protein ID: 121999287
T4SS name [ID]VirB [472]
Gene symbol-
Locus tagCJJ81176_pTet0036
StrainCampylobacter jejuni subsp. jejuni 81-176
Repliconplasmid pTet [GenBank: NC_008790] [Browse all T4SS(s) in this replicon]
Location [Strand]28517..29179 [+]
ProductcmgB8
Component typeVirB8
UniProt IDA1WZX6, Q847A8
KEGG IDcjj:CJJ81176_pTet0036
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.3e-60, Aligned region: 9..217
Protein Sequence: 220 a.a.     [Download]
>gi|121999287|ref|YP_001004040.1| cmgB8 [Campylobacter jejuni subsp. jejuni 81-176]
MKNEFNTAIDYEASFRYLIEKSNKRAWLIAFISIFIAIISIIAVVLLTPLKTIEPYVIRVDNTTGMVDIL
TMLDEKEIKANEALDKYFISTYVKAREGYYYDLLNQDYLLTQLMSSEKVANEYRALYEGDNARDQILKNS
NEVSVQILSIVLGESNGVKTATVRAIITTKNLTSKGTTQATKVITLSYDYILAKASEENRFLNPLGFKVL
TYRIDDEVAQ
 
Nucleotide Sequence: 663 bp     [Download]
>gi|121999251|ref|NC_008790.1|:28517-29179 Campylobacter jejuni subsp. jejuni 81-176 plasmid pTet, complete sequence
ATGAAAAATGAGTTTAATACTGCAATAGATTATGAAGCAAGTTTTAGATACTTAATTGAAAAAAGTAATA
AAAGAGCTTGGCTTATTGCTTTTATTTCTATTTTTATAGCCATTATTTCCATTATAGCTGTTGTTTTACT
TACTCCTTTAAAAACAATAGAACCTTATGTAATAAGAGTAGACAATACTACAGGAATGGTTGATATTTTA
ACCATGCTTGATGAAAAAGAAATTAAAGCAAATGAAGCATTAGATAAATATTTTATTAGCACTTATGTAA
AAGCTAGAGAAGGCTATTATTATGATCTTTTAAATCAAGATTATTTACTTACTCAATTAATGAGTTCTGA
AAAAGTAGCAAATGAATATAGGGCTTTATATGAAGGTGATAATGCAAGAGATCAAATTCTAAAAAACTCC
AATGAAGTAAGTGTTCAAATTTTAAGTATTGTTTTAGGAGAAAGTAACGGAGTGAAAACTGCTACAGTCA
GGGCAATTATTACTACAAAAAATTTAACTTCCAAAGGAACAACTCAAGCAACAAAAGTAATAACATTAAG
TTATGACTATATCTTAGCAAAAGCTAGCGAAGAAAACAGATTTTTAAATCCTTTAGGTTTTAAAGTATTA
ACTTATAGAATTGATGACGAGGTGGCACAATGA
 Primer design