SecReT4
Protein ID: 121999291
T4SS name [ID]VirB [472]
Gene symbol-
Locus tagCJJ81176_pTet0040
StrainCampylobacter jejuni subsp. jejuni 81-176
Repliconplasmid pTet [GenBank: NC_008790] [Browse all T4SS(s) in this replicon]
Location [Strand]32239..34050 [+]
ProductcmgD4
Component typeVirD4
UniProt IDQ69B94, A1WZY0
KEGG IDcjj:CJJ81176_pTet0040
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 7.8e-105, Aligned region: 93..565
TraG-D_C [PF12696], Evalue: 3.9e-26, Aligned region: 406..528
TrwB_AAD_bind [PF10412], Evalue: 2.3e-17, Aligned region: 345..542
Protein Sequence: 603 a.a.     [Download]
>gi|121999291|ref|YP_001004044.1| cmgD4 [Campylobacter jejuni subsp. jejuni 81-176]
MQNNKSIQMIFLAIASFILTYLITPIVFFFLNKVKIMKAIEIYNINFTLQAISNGYPKIWLSLGITFGIC
FVVFSVLVLSLKAKKSQFGEARFANFNEIKKMNLFSDNGIIIGKYKGKILRFSGQQFVALGAPTRSGKGV
GIVIPNLLEWRESAVVQDIKQECFDYTSKYRKEILGQEVYLFNPFSRQTHRYNPLTYIDMSDKEHCDSQL
MDLGNILYPQDGDSTSKFFNGLAQNLFIGLCYLWRDLQLTDYGKEFQSAFDINVGEFNFYNILQLSKGFS
LKNEGKTLKGFDDTYNFLSYCEVLDEATIRRLETYFNINSDATKSGVMSSFNAPLVPFESETLRLSTETS
DFDLRDLRKKKMTIYIGITPDQLANAQFILNIFWSQLILLNTKELPQSNKDLKYTCLMVMDEFTAPGRIP
IYQSAISFMAGYWLRSLMIYQSNSQLETQPPLGYGKEGAKTLLTNHACQIFYAPREQEDAEAISRILGNT
TFKTKSRSINTGNNGGGSHSISEASRALMLPQELREMPFENELITIDSGKPILCNKAFYYSDSYFMDKFK
AVSKSLSTIRKIPSRKQLEDAILKGECKVKIQIIGENNDKKIA
 
Nucleotide Sequence: 1812 bp     [Download]
>gi|121999251|ref|NC_008790.1|:32239-34050 Campylobacter jejuni subsp. jejuni 81-176 plasmid pTet, complete sequence
ATGCAAAATAATAAAAGCATTCAAATGATTTTTCTTGCTATAGCGAGTTTTATTCTCACTTACTTAATAA
CGCCCATTGTTTTTTTCTTTTTAAATAAAGTAAAAATAATGAAAGCGATTGAAATTTATAACATAAATTT
TACGCTACAAGCAATCTCTAATGGTTATCCAAAAATATGGCTTTCTTTAGGTATTACTTTTGGCATTTGT
TTTGTTGTTTTTTCTGTTTTGGTGTTATCTTTAAAAGCCAAAAAATCTCAATTTGGCGAAGCTAGATTTG
CAAATTTTAATGAAATTAAAAAAATGAATTTATTTTCAGATAATGGAATAATTATCGGAAAATACAAGGG
AAAGATTTTAAGATTTAGCGGTCAGCAATTTGTAGCCTTAGGAGCACCCACAAGAAGTGGTAAAGGCGTA
GGTATAGTAATACCAAACTTGTTAGAGTGGCGAGAAAGTGCTGTTGTTCAAGATATTAAACAAGAATGTT
TTGACTACACAAGCAAATATAGAAAAGAGATTTTAGGACAAGAAGTTTATTTATTCAATCCATTTTCAAG
ACAGACACATCGCTATAATCCTTTAACTTATATTGATATGAGTGATAAAGAGCATTGCGATAGTCAATTA
ATGGATTTAGGTAACATACTCTACCCACAAGATGGGGATTCTACCTCAAAATTTTTCAATGGCTTAGCAC
AAAACTTATTTATTGGGCTTTGTTATTTATGGCGTGATTTACAATTAACCGATTATGGAAAAGAATTTCA
AAGTGCGTTTGATATTAATGTAGGAGAATTTAACTTTTACAATATTTTGCAACTCTCAAAAGGTTTCTCA
CTTAAAAATGAAGGAAAAACTTTAAAAGGATTTGATGATACATACAATTTCTTATCTTATTGTGAAGTTT
TAGATGAAGCAACCATAAGGCGTTTAGAAACTTATTTTAATATTAACTCAGATGCTACTAAATCAGGTGT
AATGAGCTCTTTTAATGCTCCGCTTGTGCCATTTGAAAGTGAAACATTAAGATTAAGCACAGAAACAAGC
GATTTTGATTTGCGAGATTTGCGTAAAAAGAAAATGACAATTTATATAGGAATTACGCCTGATCAATTAG
CAAATGCACAATTTATTTTAAATATTTTTTGGTCGCAACTTATTTTATTAAACACCAAAGAATTGCCACA
AAGCAATAAAGATTTAAAATATACTTGTTTAATGGTTATGGATGAATTTACTGCACCTGGTAGAATTCCT
ATCTATCAATCAGCAATCAGTTTTATGGCTGGTTATTGGTTAAGATCTTTGATGATTTATCAATCAAATT
CACAACTTGAAACACAACCACCTTTGGGCTATGGAAAAGAAGGAGCTAAAACACTCTTAACAAATCATGC
TTGTCAGATTTTCTATGCGCCAAGAGAGCAAGAAGACGCAGAAGCTATCTCTAGGATTTTAGGAAATACT
ACTTTTAAAACAAAATCAAGAAGTATTAATACAGGCAATAATGGAGGTGGATCACATAGTATTAGCGAAG
CAAGTAGGGCTTTAATGTTGCCACAAGAACTTAGAGAAATGCCTTTTGAAAATGAACTAATTACTATTGA
TAGTGGAAAACCTATTTTATGCAATAAAGCATTTTATTATTCAGATTCTTATTTTATGGATAAATTTAAA
GCTGTTTCGAAAAGTTTATCAACAATAAGAAAAATCCCTTCACGCAAACAATTAGAAGATGCGATCTTAA
AGGGAGAATGTAAAGTAAAAATTCAAATTATAGGAGAAAACAATGATAAAAAAATCGCTTGA
 Primer design