SecReT4
Protein ID: 123443655
T4SS name [ID]Tfc [708]
Gene symbol-
Locus tagYE3465
StrainYersinia enterocolitica subsp. enterocolitica 8081
Repliconchromosome [GenBank: NC_008800] [Browse all T4SS(s) in this replicon]
Location [Strand]3777818..3779338 [-]
Producthypothetical protein
Component typeTfc19
UniProt IDA1JPY6
KEGG IDyen:YE3465
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 6.2e-108, Aligned region: 8..474
Protein Sequence: 506 a.a.     [Download]
>gi|123443655|ref|YP_001007626.1| hypothetical protein YE3465 [Yersinia enterocolitica subsp. enterocolitica 8081]
MTANSFLEYFLVLFGWMLNNALWNILLGTGLFALPLVFKVFGIWLKVREEGADEGNKGVLALPRVEHAIY
VSFCVMLFCCIPLLPVDISTIQFDSSRTKQCGVNVPAPQNSGYKALVNDFDGKTAEVPVWWYLLHMVSKG
TTQAMTASIPCGNQLRQLRFDVQNTKIRDPIVQQEVQDFAGQCYSRAYFKLKNSNSQLSDATINSVGWMG
SRYFLTVGGYYDHYTSTEPRSLWPYDNNRDNGYPDVGRGGYPTCKQWWSDANNGLKTRVLANLTAATKIA
LQLRYSKDQWEEMALRWLVSPRNVDLSGRGETYAISGNDATSGLMGNVTRLVSSVGLGLKQAEALPGFDA
LKQALPMIQALLEMMIIIAIPILMMFSAYEPKTVVTISFALFALMFITFWWELAGWLDDRLITILYDNMA
DQGIINSSVPFAGFFSSTTDGWIMNLVLGMMYVVFPMFWLTMLSWIGVRIGDMARAITDGGKMPQVAGES
GGKIAAGAANTVARKG
 
Nucleotide Sequence: 1521 bp     [Download]
>gi|123440403|ref|NC_008800.1|:c3779338-3777818 Yersinia enterocolitica subsp. enterocolitica 8081 chromosome, complete genome
ATGACGGCAAACAGTTTCCTTGAATATTTCCTGGTGCTGTTCGGGTGGATGCTAAACAACGCGCTGTGGA
ATATTTTGCTGGGCACAGGACTGTTCGCCTTGCCACTGGTGTTTAAAGTGTTCGGTATTTGGCTAAAAGT
GCGTGAAGAGGGCGCGGATGAAGGCAATAAAGGGGTGCTGGCGCTGCCGCGCGTGGAACATGCCATCTAC
GTATCATTTTGTGTCATGTTGTTTTGCTGCATCCCCTTGCTGCCGGTGGATATCAGCACCATCCAGTTTG
ACAGCTCCCGCACCAAACAATGTGGTGTAAACGTCCCTGCGCCACAAAATTCTGGTTATAAGGCACTGGT
CAATGATTTTGATGGCAAAACAGCAGAAGTACCGGTGTGGTGGTATCTACTACACATGGTATCGAAAGGC
ACCACTCAGGCCATGACAGCTTCTATCCCTTGTGGTAATCAACTGCGGCAACTGCGTTTTGACGTGCAAA
ACACCAAGATCCGTGACCCCATCGTGCAACAGGAAGTGCAGGATTTTGCAGGTCAGTGTTACTCGCGCGC
TTACTTTAAGCTGAAGAACAGCAATAGCCAATTGAGTGATGCCACTATCAATAGTGTGGGCTGGATGGGG
AGTCGATATTTTCTCACGGTTGGGGGCTACTATGACCATTACACTTCGACTGAACCGCGCAGTCTGTGGC
CCTATGATAACAACAGAGACAATGGCTATCCTGATGTCGGTCGGGGCGGCTATCCGACGTGTAAACAGTG
GTGGTCTGATGCCAATAACGGCCTAAAAACGCGTGTTCTGGCCAACCTTACCGCCGCCACTAAAATAGCG
CTACAGCTCAGGTACAGTAAAGATCAGTGGGAAGAAATGGCCCTGCGTTGGCTGGTAAGCCCACGTAACG
TTGACCTATCTGGTCGTGGTGAGACTTATGCAATAAGCGGTAATGATGCCACATCTGGACTGATGGGGAA
CGTCACTCGCCTGGTCTCTTCCGTTGGGTTAGGGTTGAAGCAAGCAGAGGCTTTGCCTGGATTTGATGCG
CTGAAACAGGCGCTGCCAATGATTCAGGCATTACTTGAGATGATGATCATTATCGCCATCCCGATATTGA
TGATGTTCAGTGCCTACGAGCCGAAAACGGTGGTGACTATTTCCTTTGCGTTATTTGCCCTGATGTTCAT
TACGTTCTGGTGGGAACTGGCGGGCTGGCTTGATGACAGATTGATCACCATTCTTTATGACAATATGGCG
GATCAAGGGATTATTAACAGCAGCGTGCCGTTCGCCGGGTTCTTCAGTTCGACAACTGATGGTTGGATCA
TGAATCTAGTATTGGGGATGATGTATGTGGTTTTCCCCATGTTTTGGCTCACTATGCTGAGTTGGATTGG
TGTGAGAATAGGTGACATGGCCAGGGCGATAACTGATGGCGGCAAAATGCCTCAGGTCGCAGGCGAGTCA
GGAGGGAAAATAGCAGCTGGTGCAGCTAACACGGTAGCTCGTAAGGGGTAA
 Primer design