SecReT4
Protein ID: 123443656
T4SS name [ID]Tfc [708]
Gene symbol-
Locus tagYE3466
StrainYersinia enterocolitica subsp. enterocolitica 8081
Repliconchromosome [GenBank: NC_008800] [Browse all T4SS(s) in this replicon]
Location [Strand]3779338..3780744 [-]
Producthypothetical protein
Component typeTfc22
UniProt IDA1JPY7
KEGG IDyen:YE3466
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 468 a.a.     [Download]
>gi|123443656|ref|YP_001007627.1| hypothetical protein YE3466 [Yersinia enterocolitica subsp. enterocolitica 8081]
MTHHNYFFLRLMATAFVLIGSVAAGAASVSNNGLSASGAISDGLFYSIGGGTVISPSSSRNNMTRLGMTG
SWNSDLMCGNFDLKTTVGNQLNGVTSGFKDLMSDVIQGATGAVASMPAMVIQRANPGLYEMLTNGMLQAG
LSFDKSKLNCQNLAKKMADYTLGNKWTQAAVTEEYKSIVASSDGDAVSSDHQLHKATGEEGTTWIGGRKR
GGKGQPAIKPTHDLAKAGYNMMNNLPVTSNHLIGSANCNGAACLRYKNSEEAATAVVKVLGDRSIRTCRE
ASACSSGGGENRSGSTVAGSGFSPMIEETTKENLEQLIKLVGGREKPTTESLAKLKTGGLVVTRGVIQSL
KDDPDNSALIQRLAGELAMADTVENALTMRRMLTTGQAEPNAADQPEALAEGDRRIEALDRELAALRNEM
ELRKAISNNSLLTTLERQGRRNQDNRLQQQSGDQDQGFSQMSQKTREP
 
Nucleotide Sequence: 1407 bp     [Download]
>gi|123440403|ref|NC_008800.1|:c3780744-3779338 Yersinia enterocolitica subsp. enterocolitica 8081 chromosome, complete genome
ATGACACACCATAATTATTTCTTCCTGCGGCTGATGGCTACGGCTTTCGTGTTAATTGGCAGCGTTGCTG
CTGGTGCGGCTTCTGTATCCAATAATGGCTTGTCAGCAAGTGGTGCCATCAGCGATGGCTTGTTCTACTC
CATCGGGGGCGGCACCGTCATTTCGCCATCTTCTTCACGAAACAACATGACCCGCTTGGGCATGACTGGA
AGCTGGAATAGTGACCTGATGTGCGGCAATTTTGACCTGAAAACCACAGTAGGTAATCAGCTCAACGGGG
TAACCAGCGGTTTTAAGGATTTGATGAGTGATGTGATTCAAGGGGCGACTGGAGCGGTGGCCAGCATGCC
AGCGATGGTTATCCAACGCGCTAATCCGGGCCTGTATGAAATGCTGACCAATGGGATGCTACAAGCTGGT
CTGAGCTTCGATAAATCAAAACTCAACTGTCAGAATTTGGCGAAAAAAATGGCCGATTACACCTTGGGGA
ACAAGTGGACGCAGGCTGCGGTGACTGAAGAATACAAGAGCATTGTTGCCTCAAGTGACGGTGATGCGGT
TAGCAGCGACCATCAATTACACAAGGCCACCGGCGAAGAGGGCACCACTTGGATTGGCGGGCGAAAGCGC
GGTGGCAAAGGCCAGCCAGCCATTAAGCCCACACATGATCTCGCTAAAGCGGGTTACAACATGATGAATA
ATTTGCCGGTTACCAGTAACCACTTGATAGGTTCTGCAAACTGCAATGGAGCAGCTTGTCTGCGCTATAA
AAACTCAGAAGAAGCCGCGACCGCAGTGGTAAAAGTGCTCGGTGATCGTTCTATACGCACCTGCCGCGAA
GCCAGTGCGTGCAGCAGCGGTGGTGGCGAGAACAGGTCTGGCAGTACCGTTGCGGGCAGCGGATTTTCTC
CCATGATTGAAGAAACTACCAAAGAGAATCTGGAGCAATTGATTAAGTTGGTTGGCGGGCGGGAGAAACC
CACAACAGAAAGTCTGGCGAAGCTGAAAACGGGAGGCCTTGTTGTTACCCGAGGAGTGATCCAATCGCTG
AAAGATGATCCAGACAATTCGGCGTTGATACAGCGGCTGGCGGGTGAGCTGGCCATGGCTGACACCGTGG
AAAATGCGCTGACCATGCGACGGATGCTCACTACCGGCCAGGCGGAGCCTAATGCCGCGGATCAGCCTGA
AGCCCTGGCCGAAGGAGACCGGCGTATTGAGGCACTGGATCGCGAGCTTGCCGCACTGCGTAATGAAATG
GAACTGCGTAAGGCCATCAGTAATAACAGCCTGCTTACCACGCTTGAGCGTCAGGGGCGACGTAATCAGG
ACAACCGTCTACAGCAGCAGAGCGGGGATCAAGATCAGGGCTTTAGCCAGATGAGCCAGAAAACGAGAGA
ACCCTAA
 Primer design