SecReT4
Protein ID: 123443657
T4SS name [ID]Tfc [708]
Gene symbol-
Locus tagYE3467
StrainYersinia enterocolitica subsp. enterocolitica 8081
Repliconchromosome [GenBank: NC_008800] [Browse all T4SS(s) in this replicon]
Location [Strand]3780765..3781718 [-]
Producthypothetical protein
Component typeTfc23
UniProt IDA1JPY8
KEGG IDyen:YE3467
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 1.1e-93, Aligned region: 32..308
Protein Sequence: 317 a.a.     [Download]
>gi|123443657|ref|YP_001007628.1| hypothetical protein YE3467 [Yersinia enterocolitica subsp. enterocolitica 8081]
MILSSLRYRRLLPLILLVGSSQCMASVNTASLIASAASASCISWKVKGICYWLLCTPLGCSVKTSVKVEH
FTPQVVVSAYNGSGDNPWMEMAAVSRAASGVESGITGMFTGGGQQQMKAPGLRQQNLRYHYADAYGHPAT
SLMGGHIAGYSCRSAATPFAPYFVSALDALVWRSGLPESLYPEALIPGQRELGRQSNANMWGNIYPRSGF
VTQQDSYKSAAVVAQRVADIITRYGQLHVYQPLVGQSSLGYWPPESVRENTGNQNHKWQRLEPRLSTTCA
IFPDANGPIAQDGNYAWALWQPYSCCKRRGQTLLLPH
 
Nucleotide Sequence: 954 bp     [Download]
>gi|123440403|ref|NC_008800.1|:c3781718-3780765 Yersinia enterocolitica subsp. enterocolitica 8081 chromosome, complete genome
ATGATCCTCTCATCTTTACGCTATCGGCGATTATTACCGCTCATTCTTTTGGTGGGTAGCAGTCAGTGTA
TGGCGAGCGTCAACACAGCAAGCCTGATTGCTAGTGCGGCCAGCGCTTCGTGCATCAGTTGGAAAGTAAA
AGGCATCTGCTACTGGTTGTTGTGTACGCCTTTGGGTTGCTCAGTGAAAACCTCTGTCAAGGTCGAACAT
TTTACTCCCCAAGTTGTGGTCTCCGCGTACAACGGTTCCGGCGATAATCCTTGGATGGAGATGGCTGCTG
TCAGCAGAGCCGCCAGTGGGGTTGAAAGCGGTATTACGGGTATGTTTACTGGCGGTGGTCAACAGCAAAT
GAAGGCACCTGGCTTACGTCAACAGAACCTGCGCTACCATTATGCAGATGCCTATGGACATCCGGCGACC
TCGCTGATGGGGGGGCATATTGCAGGCTATTCCTGCCGTTCAGCCGCCACTCCTTTTGCCCCTTATTTTG
TCAGTGCCCTCGATGCTTTGGTATGGCGCAGTGGTTTGCCTGAATCTCTCTATCCAGAAGCACTCATCCC
CGGGCAACGTGAACTGGGTCGCCAGTCAAACGCCAATATGTGGGGGAATATTTACCCTCGTAGTGGTTTT
GTTACCCAGCAAGATAGCTATAAATCCGCTGCGGTAGTCGCCCAGCGGGTTGCCGATATCATTACCCGTT
ATGGTCAACTGCATGTTTATCAACCCTTGGTTGGCCAATCTTCGCTGGGCTATTGGCCACCCGAATCGGT
TCGTGAGAATACCGGTAATCAGAATCATAAATGGCAGCGTCTGGAGCCCCGACTCTCAACGACCTGCGCT
ATTTTTCCAGATGCTAATGGCCCCATCGCTCAGGATGGTAACTATGCCTGGGCACTTTGGCAACCTTACA
GTTGCTGTAAGCGACGTGGACAAACCTTACTCTTACCTCACTGA
 Primer design