SecReT4
Protein ID: 123443675
T4SS name [ID]Tfc [708]
Gene symbol-
Locus tagYE3487
StrainYersinia enterocolitica subsp. enterocolitica 8081
Repliconchromosome [GenBank: NC_008800] [Browse all T4SS(s) in this replicon]
Location [Strand]3799474..3799848 [-]
Productputative inner membrane protein
Component typeTfc11
UniProt IDA1JQ11
KEGG IDyen:YE3487
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 8.5e-39, Aligned region: 3..121
Protein Sequence: 124 a.a.     [Download]
>gi|123443675|ref|YP_001007646.1| putative inner membrane protein [Yersinia enterocolitica subsp. enterocolitica 8081]
MAVIEFLPERLNTPPVIWRGFTSGEFLLAACCGFLLGIPVSIPFVFISALGWIAIPTGMLIMPILVVFIG
GRWVSQYKRGKPDNYLWRRLEEVRVRLGWAQNLIIISRAWALRRSYPFHRRRTE
 
Nucleotide Sequence: 375 bp     [Download]
>gi|123440403|ref|NC_008800.1|:c3799848-3799474 Yersinia enterocolitica subsp. enterocolitica 8081 chromosome, complete genome
ATGGCCGTCATTGAGTTTCTTCCCGAACGCCTGAATACGCCGCCTGTTATTTGGCGTGGGTTCACTTCCG
GTGAATTCCTTCTTGCGGCTTGTTGTGGGTTTTTATTGGGTATCCCGGTCTCTATTCCATTCGTTTTCAT
CTCCGCACTGGGTTGGATAGCTATCCCAACAGGTATGTTGATTATGCCTATTCTGGTCGTTTTTATCGGT
GGCCGATGGGTCAGTCAATATAAGCGAGGCAAACCGGATAATTACCTCTGGCGGCGCTTGGAGGAGGTGC
GTGTGCGGCTTGGATGGGCGCAAAACCTCATTATTATTAGCCGAGCATGGGCGTTACGACGTTCGTATCC
ATTTCACCGGAGGCGTACCGAATGA
 Primer design