SecReT4
Protein ID: 123443678
T4SS name [ID]Tfc [708]
Gene symbol-
Locus tagYE3490
StrainYersinia enterocolitica subsp. enterocolitica 8081
Repliconchromosome [GenBank: NC_008800] [Browse all T4SS(s) in this replicon]
Location [Strand]3800469..3800777 [-]
Producthypothetical protein
Component typeTfc9
UniProt IDA1JQ14
KEGG IDyen:YE3490
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 2.3e-28, Aligned region: 19..97
Protein Sequence: 102 a.a.     [Download]
>gi|123443678|ref|YP_001007649.1| hypothetical protein YE3490 [Yersinia enterocolitica subsp. enterocolitica 8081]
MRLLPKLSVLLLTVASTLPIQAAEKDELALVMRQLDQVQASFDRARVVANQNGLDARFYFDYLSAINDIT
AMKQGIESYLAPSRAQPSLPMSVTGQYRKENH
 
Nucleotide Sequence: 309 bp     [Download]
>gi|123440403|ref|NC_008800.1|:c3800777-3800469 Yersinia enterocolitica subsp. enterocolitica 8081 chromosome, complete genome
ATGCGCCTATTACCCAAACTCAGCGTATTGCTACTGACGGTGGCCAGCACGCTCCCAATTCAAGCGGCCG
AAAAAGATGAACTGGCGTTGGTTATGCGCCAACTCGATCAGGTTCAGGCCAGTTTTGATCGCGCCCGCGT
CGTGGCTAATCAGAACGGCTTGGATGCTCGATTTTATTTCGATTACCTCAGCGCCATAAACGACATCACC
GCCATGAAACAGGGGATTGAGAGCTATCTTGCCCCTTCGCGTGCCCAGCCATCACTGCCTATGTCGGTCA
CCGGTCAGTATCGCAAGGAGAATCATTGA
 Primer design