SecReT4
Protein ID: 123443679
T4SS name [ID]Tfc [708]
Gene symbol-
Locus tagYE3492
StrainYersinia enterocolitica subsp. enterocolitica 8081
Repliconchromosome [GenBank: NC_008800] [Browse all T4SS(s) in this replicon]
Location [Strand]3801682..3802434 [-]
Productputative inner membrane protein
Component typeTfc8
UniProt IDA1JQ15
KEGG IDyen:YE3492
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 2.6e-75, Aligned region: 49..247
Protein Sequence: 250 a.a.     [Download]
>gi|123443679|ref|YP_001007650.1| putative inner membrane protein [Yersinia enterocolitica subsp. enterocolitica 8081]
MAQENTPPRRNVEPPKKPGLFMSLFWHLPWTIIGILLASWLVSLLIEYIGMIFFWASEGAEHSKQVMFTE
RAYLSEGFTRSLLMSEPATLISYWIQQAYQWLFVDSGFIRWINDGRQVKTQEGALQSLNLFGSWLARVLW
EYLQATVYVTVIFFIRVAILVLSIPLFIMVCANGVVDGLVRRDLRRYGAGYESSFIYHHAKRFVKPAMVG
PCMLYLSWPTAVWPNLLLLPAAVALGMMVSVVVGAFKKYL
 
Nucleotide Sequence: 753 bp     [Download]
>gi|123440403|ref|NC_008800.1|:c3802434-3801682 Yersinia enterocolitica subsp. enterocolitica 8081 chromosome, complete genome
ATGGCTCAGGAGAATACGCCGCCACGGCGCAACGTTGAACCGCCTAAAAAACCGGGCCTGTTTATGTCTC
TGTTCTGGCATCTGCCATGGACGATTATCGGCATCTTGCTAGCTTCATGGCTGGTCAGCTTATTGATTGA
GTACATCGGCATGATATTTTTCTGGGCTAGTGAAGGTGCGGAACACAGCAAACAGGTGATGTTCACAGAA
CGCGCATATTTATCTGAGGGTTTTACCCGCAGTCTTTTGATGTCCGAACCGGCCACACTCATCAGTTATT
GGATTCAACAGGCTTACCAATGGTTGTTTGTAGATAGCGGCTTTATTCGCTGGATAAATGATGGGCGGCA
GGTAAAAACACAGGAAGGGGCGCTTCAGTCACTCAATCTCTTCGGTAGTTGGCTGGCTAGGGTGCTCTGG
GAATATTTACAGGCGACAGTCTATGTAACGGTTATTTTCTTCATCCGTGTGGCGATTCTGGTGCTGTCTA
TCCCGCTGTTTATCATGGTGTGTGCCAATGGAGTCGTGGACGGTTTGGTTCGCCGAGACCTGCGACGTTA
TGGTGCCGGTTACGAATCCAGTTTTATTTATCATCATGCTAAACGCTTTGTTAAGCCTGCGATGGTTGGG
CCTTGCATGCTGTATTTGTCCTGGCCAACAGCGGTGTGGCCCAATTTACTGCTACTGCCAGCAGCGGTGG
CTCTGGGCATGATGGTGTCGGTGGTGGTGGGGGCGTTTAAGAAGTATTTGTGA
 Primer design