SecReT4
Protein ID: 123443680
T4SS name [ID]Tfc [708]
Gene symbol-
Locus tagYE3493
StrainYersinia enterocolitica subsp. enterocolitica 8081
Repliconchromosome [GenBank: NC_008800] [Browse all T4SS(s) in this replicon]
Location [Strand]3802434..3804554 [-]
ProductTraG-family protein
Component typeTfc6
UniProt IDA1JQ16
KEGG IDyen:YE3493
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 3.7e-16, Aligned region: 504..634
TrwB_AAD_bind [PF10412], Evalue: 1.5e-13, Aligned region: 186..225
TrwB_AAD_bind [PF10412], Evalue: 1.5e-13, Aligned region: 500..644
AAA_10 [PF12846], Evalue: 2.3e-12, Aligned region: 187..581
Protein Sequence: 706 a.a.     [Download]
>gi|123443680|ref|YP_001007651.1| TraG-family protein [Yersinia enterocolitica subsp. enterocolitica 8081]
MSDRYVMESLLRPAVELYTATTAWSTVYVCLTAPWAVALAPSVSWVTAAGFGVLALKRTHQGLRILRYRR
NIRRMPRYAMSSRQIPISHRYLFLGRGFQWTQKHTQRLLEARRPETEHYVQPSLTYRMARYLEKRLESSL
PWLCRLTQADTCLNPVRPLPPVGGSPIYHGVELNERNVLYDLGERVGHTLVIGTTRVGKTRLAEVMITQD
IRRGDVTVMFDPKGDADLLKRMWAETRRAGRENEFYVFHLGWPDISARYNAIGRFSRISEVASRVAGQLS
GEGNSAAFREFAWRFVNIITRALVALGQRPDYGLILRYVTNIGELYETYVENLLTVQAPQLWLNVQNVIS
SNMLKERDLPRNMQGQANAMKVWAIETVLSSDAGKKLWDPVLDGLRSAVRYDRTYFDKIVASLLPLLEKL
TTGKTAALLAPDYNDMNDTRPIFDWQEVIRKKGIVYVGLDALSDPEVASAVGNSMFADLVSVAGHIYKFG
ISDEIGAKTQKKVPINLHCDEFNELMGDEFIPLINKGGGAGIQVTAYTQTLSDIEARVGSSAKAKQVVGN
FNSLIMLRVRENSTAELLTSQLPEVDVYTKTLVSGVTDMTNPEQDSDFTSNVQDRVSSIRMPMVTPADII
NLPKGQAFALLEGGQLWKIRMPLPDGSNDQLMPESISRIAEYMQQNYRTGENWWLGSALPSDILAASAFS
QGDAEN
 
Nucleotide Sequence: 2121 bp     [Download]
>gi|123440403|ref|NC_008800.1|:c3804554-3802434 Yersinia enterocolitica subsp. enterocolitica 8081 chromosome, complete genome
ATGAGCGACAGGTATGTGATGGAATCCCTATTGCGTCCCGCCGTCGAGTTGTACACGGCAACCACGGCGT
GGAGTACCGTTTACGTTTGCCTGACAGCACCTTGGGCGGTGGCATTGGCACCGTCTGTCAGTTGGGTGAC
GGCGGCTGGCTTTGGTGTTCTTGCTTTGAAACGAACCCACCAAGGGCTGCGTATTCTGCGCTATCGGCGC
AACATCCGGCGGATGCCCCGTTATGCAATGAGTAGCCGACAAATCCCCATCAGCCACCGATATCTGTTTC
TGGGGCGCGGGTTTCAGTGGACACAAAAACACACTCAGCGCCTGCTGGAGGCGCGCCGTCCAGAGACCGA
ACATTATGTGCAGCCATCGCTCACCTATCGTATGGCTCGGTATTTGGAAAAACGGCTGGAGTCCAGCTTG
CCATGGCTGTGTCGGCTGACGCAGGCCGATACTTGTTTAAATCCAGTAAGACCGCTGCCGCCTGTCGGGG
GCAGCCCAATCTATCACGGTGTTGAATTAAATGAACGTAACGTTCTGTATGACTTGGGAGAACGTGTTGG
CCACACACTGGTTATCGGTACCACCCGCGTGGGAAAAACTCGTTTAGCTGAGGTTATGATCACGCAGGAT
ATCCGTCGCGGGGATGTGACAGTCATGTTCGACCCCAAAGGGGACGCAGATCTGCTTAAACGTATGTGGG
CGGAAACGCGTAGAGCGGGGCGTGAGAATGAGTTCTATGTATTCCACTTGGGCTGGCCAGATATTAGTGC
CCGTTACAATGCCATTGGTCGCTTCAGCCGGATCTCTGAAGTCGCTTCACGCGTGGCCGGGCAATTATCC
GGTGAAGGTAATTCAGCCGCGTTTCGTGAATTCGCCTGGCGCTTTGTGAACATCATTACCCGGGCATTAG
TCGCCCTTGGGCAGCGCCCTGATTACGGACTCATCCTGCGCTATGTGACCAATATTGGCGAACTTTATGA
GACTTATGTAGAAAACCTGCTAACCGTACAAGCCCCTCAGCTCTGGCTGAATGTTCAGAACGTGATCAGT
TCGAACATGCTGAAAGAGCGTGATCTTCCCCGAAATATGCAGGGCCAGGCCAATGCCATGAAAGTGTGGG
CGATCGAGACGGTACTCAGCAGTGATGCCGGCAAGAAATTGTGGGATCCAGTGCTGGATGGTCTACGCAG
TGCGGTTCGTTATGATCGTACCTATTTTGACAAGATCGTGGCTTCGTTACTGCCACTGTTGGAAAAACTC
ACTACCGGTAAAACCGCGGCTCTGCTGGCACCTGATTACAATGATATGAATGATACGCGGCCGATTTTTG
ACTGGCAGGAAGTGATCCGTAAAAAGGGGATTGTGTATGTTGGTCTCGATGCACTGTCTGATCCTGAAGT
GGCGTCAGCGGTGGGCAACAGTATGTTTGCTGATCTGGTCTCAGTTGCGGGCCATATCTACAAATTTGGT
ATCAGTGATGAAATTGGCGCTAAAACGCAGAAGAAAGTGCCGATTAACCTGCATTGCGACGAGTTCAACG
AGTTGATGGGGGATGAGTTCATCCCATTAATTAACAAAGGGGGCGGGGCAGGTATCCAGGTGACGGCGTA
CACTCAGACGCTTTCAGACATTGAAGCGCGAGTGGGCAGTAGTGCTAAAGCGAAGCAGGTTGTTGGTAAT
TTCAACTCCCTGATTATGCTAAGGGTACGTGAAAACAGTACCGCCGAACTGCTGACCAGCCAACTGCCGG
AAGTCGATGTTTATACTAAAACGTTGGTCTCAGGTGTAACGGATATGACTAACCCTGAGCAGGATTCCGA
TTTCACCAGTAATGTACAAGACCGTGTGAGTAGCATCCGTATGCCCATGGTCACGCCAGCAGATATTATC
AACCTGCCCAAAGGTCAGGCGTTTGCACTGCTCGAAGGTGGGCAACTGTGGAAGATCAGAATGCCTCTTC
CTGATGGTAGCAATGATCAGTTGATGCCGGAAAGCATCAGCCGGATAGCCGAGTATATGCAGCAGAATTA
CCGTACTGGGGAAAATTGGTGGTTGGGGAGTGCGCTACCGTCCGATATTTTGGCCGCGTCAGCTTTTAGT
CAAGGGGACGCTGAAAATTAA
 Primer design