SecReT4
Protein ID: 123443681
T4SS name [ID]Tfc [708]
Gene symbol-
Locus tagYE3494
StrainYersinia enterocolitica subsp. enterocolitica 8081
Repliconchromosome [GenBank: NC_008800] [Browse all T4SS(s) in this replicon]
Location [Strand]3804740..3805234 [-]
Producthypothetical protein
Component typeTfc5
UniProt IDA1JQ27
KEGG IDyen:YE3494
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 1.7e-47, Aligned region: 18..162
Protein Sequence: 164 a.a.     [Download]
>gi|123443681|ref|YP_001007652.1| hypothetical protein YE3494 [Yersinia enterocolitica subsp. enterocolitica 8081]
MMSAIFISPINYAALTVVGDLGGELAEPYLDAVSAQPNEFSPAEKWALPSPPTFVSIAAALPVHTPELTP
GAVSARALNLPGIPPIFIVGDDELSRQWLSLHANKLQRTGATGFVVNVTDLSRLQSLNALVPEVEMAPVS
GSDLARRLQLTHYPLLITEKGLTQ
 
Nucleotide Sequence: 495 bp     [Download]
>gi|123440403|ref|NC_008800.1|:c3805234-3804740 Yersinia enterocolitica subsp. enterocolitica 8081 chromosome, complete genome
ATGATGTCAGCCATTTTCATATCCCCGATAAATTATGCTGCATTGACGGTGGTTGGAGACCTCGGTGGTG
AGTTGGCCGAACCTTATCTGGATGCCGTTAGTGCTCAGCCTAACGAATTTTCACCAGCGGAAAAATGGGC
GCTACCTTCCCCTCCGACATTTGTATCCATCGCTGCGGCACTGCCTGTTCATACTCCCGAACTGACTCCG
GGAGCCGTTTCAGCGCGAGCGCTTAATCTTCCGGGCATACCGCCGATTTTTATTGTGGGTGATGATGAGC
TATCGCGGCAGTGGCTCTCACTGCACGCTAATAAATTGCAACGCACAGGGGCCACAGGATTTGTGGTTAA
TGTAACCGATCTGTCTCGCTTGCAGAGCTTGAATGCGCTGGTTCCCGAGGTTGAGATGGCTCCGGTCTCT
GGCAGTGATCTTGCCCGCCGTTTGCAACTGACACATTACCCCTTACTCATCACTGAGAAGGGGCTGACCC
AGTAA
 Primer design