SecReT4
Protein ID: 123443682
T4SS name [ID]Tfc [708]
Gene symbol-
Locus tagYE3494A
StrainYersinia enterocolitica subsp. enterocolitica 8081
Repliconchromosome [GenBank: NC_008800] [Browse all T4SS(s) in this replicon]
Location [Strand]3805258..3805806 [-]
Producthypothetical protein
Component typeTfc4
UniProt IDA1JQ28
KEGG IDyen:YE3494A
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 182 a.a.     [Download]
>gi|123443682|ref|YP_001007653.1| hypothetical protein YE3494A [Yersinia enterocolitica subsp. enterocolitica 8081]
MQTIPSIYREIAAEARVPAEFLYSLALVESSRRFKGGERPWPWTINVAGKGYHYETREDAWQALLRFVRQ
APLKRIDVGIAQINLGWNGHFFPSFYDVFDPNTNLRVAAQILRICYENRAGSWINAAGCYHHPAGGKPAA
NYIAIVRRKLGTLAPVHITVSSKTTISDVTSVNHSLIWIEPK
 
Nucleotide Sequence: 549 bp     [Download]
>gi|123440403|ref|NC_008800.1|:c3805806-3805258 Yersinia enterocolitica subsp. enterocolitica 8081 chromosome, complete genome
TTGCAGACAATCCCCTCGATATACAGAGAAATCGCCGCTGAAGCCCGAGTGCCAGCAGAGTTCTTATACT
CGCTGGCACTGGTTGAAAGTTCACGGCGCTTTAAGGGCGGGGAGCGTCCGTGGCCATGGACGATTAACGT
GGCAGGAAAAGGGTATCATTATGAAACCCGAGAGGATGCATGGCAGGCACTACTCAGATTCGTTCGCCAA
GCGCCACTGAAGCGTATTGACGTGGGTATTGCTCAGATCAATTTGGGTTGGAATGGCCATTTTTTCCCTT
CTTTTTATGATGTTTTTGACCCTAACACCAATTTGCGTGTCGCTGCGCAAATCCTTCGTATCTGCTATGA
AAATCGTGCGGGTAGCTGGATAAACGCGGCAGGCTGCTATCACCATCCTGCCGGTGGAAAACCCGCTGCT
AACTATATCGCCATTGTGCGTCGCAAATTAGGTACCCTGGCTCCAGTACACATTACCGTATCAAGCAAGA
CGACGATCTCTGATGTTACATCGGTTAACCACTCACTCATCTGGATTGAGCCAAAATGA
 Primer design