SecReT4
Protein ID: 123443683
T4SS name [ID]Tfc [708]
Gene symbol-
Locus tagYE3495
StrainYersinia enterocolitica subsp. enterocolitica 8081
Repliconchromosome [GenBank: NC_008800] [Browse all T4SS(s) in this replicon]
Location [Strand]3805875..3806642 [-]
Producthypothetical protein
Component typeTfc3
UniProt IDA1JQ29
KEGG IDyen:YE3495
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 255 a.a.     [Download]
>gi|123443683|ref|YP_001007654.1| hypothetical protein YE3495 [Yersinia enterocolitica subsp. enterocolitica 8081]
MNRSPCFTPQKAQLLKCLPYTVVTLVLVICLGSAYANLASSVTDYSSALETLQEKSAQLQPRQNPQQWGL
SDVEWQKYLQLQQGKRGVQSPGLDPLTMLGVESEMPAERRRLAELWVKEEYQRTEKELAFQREVNAAWNR
LYSGVLSVNRGSAAGIVPNGRGRLALFVRDNCVRCDVRLAALLTDKSAVDIYLVGSDGKDGSVRQWAVSR
NIPVDRVKAGQVTLNHDRGLWRQYGQGQMPVVLQKGENGWLIAAF
 
Nucleotide Sequence: 768 bp     [Download]
>gi|123440403|ref|NC_008800.1|:c3806642-3805875 Yersinia enterocolitica subsp. enterocolitica 8081 chromosome, complete genome
TTGAATCGCTCTCCATGCTTTACGCCTCAAAAAGCTCAATTACTGAAATGCCTTCCTTATACTGTTGTAA
CACTGGTTTTAGTCATCTGTTTGGGGTCTGCCTACGCGAATTTGGCAAGTAGTGTCACGGATTACAGTTC
AGCACTTGAAACGTTACAGGAAAAATCAGCACAGCTTCAGCCCAGGCAGAACCCCCAGCAGTGGGGGCTA
AGTGATGTTGAATGGCAAAAGTATCTGCAATTACAGCAAGGTAAGCGTGGCGTACAGTCACCGGGACTTG
ATCCTCTGACGATGCTTGGTGTGGAAAGTGAAATGCCAGCAGAACGTCGTCGTTTGGCGGAACTTTGGGT
GAAAGAAGAATATCAGCGGACAGAGAAAGAACTGGCATTTCAACGTGAGGTCAACGCCGCCTGGAATCGT
CTCTATTCGGGTGTGTTGTCCGTAAATAGGGGGAGTGCGGCCGGAATCGTACCAAATGGCCGTGGTCGGC
TGGCGTTGTTTGTCCGTGATAACTGCGTTCGTTGTGACGTCAGGCTGGCTGCACTTCTCACCGATAAGAG
TGCCGTTGATATTTACCTGGTAGGCAGCGACGGAAAAGATGGCTCAGTACGTCAATGGGCTGTCAGCCGC
AATATTCCAGTGGATAGAGTAAAGGCTGGGCAGGTCACTCTGAATCACGATCGCGGTTTATGGCGACAAT
ACGGCCAAGGCCAAATGCCCGTTGTTTTGCAGAAAGGGGAGAATGGATGGCTAATCGCAGCATTCTGA
 Primer design