SecReT4
Protein ID: 123443697
T4SS name [ID]Tfc [708]
Gene symbol-
Locus tagYE3506
StrainYersinia enterocolitica subsp. enterocolitica 8081
Repliconchromosome [GenBank: NC_008800] [Browse all T4SS(s) in this replicon]
Location [Strand]3818172..3819146 [-]
Productputative type IV pilus operon lipoprotein
Component typeTfc2
UniProt IDA1JQ48
KEGG IDyen:YE3506
PDB IDNA
Domain hit(s) vs Pfam TcpQ [PF10671], Evalue: 3.4e-22, Aligned region: 236..319
Protein Sequence: 324 a.a.     [Download]
>gi|123443697|ref|YP_001007668.1| putative type IV pilus operon lipoprotein [Yersinia enterocolitica subsp. enterocolitica 8081]
MAQPNMRLWYKLVWLTLSLFAAGCTHNTTAQNESFPSVLPVPRVNDIYPNRVPEVVRYDRYTLVSSRPID
AQRDPLNQMVDITMPAKMVRSVGDGFRYVLLESGYSLCSISSSVFTELLNKPLPGVQRSIGPLRLSDALQ
ILAGPAWRLRVDDVNREVCFTLRDAYQNLAVAKPLVPAKVIIPAKNLTHQSGNFLSGSSTTTVAPVIATP
LVPLKSTLKPENIPVPSPVITPVGQLWRAEVGSTLKETLNRWAGQAKCTNGGNWVVIWPVLLDYRIDAPL
AFHGNFESVLVQIFELYRQADKPLFAQASRLQCLVAVSDIPGGR
 
Nucleotide Sequence: 975 bp     [Download]
>gi|123440403|ref|NC_008800.1|:c3819146-3818172 Yersinia enterocolitica subsp. enterocolitica 8081 chromosome, complete genome
ATGGCACAACCAAATATGCGGCTCTGGTACAAGTTGGTATGGCTCACCCTATCACTATTTGCCGCTGGTT
GTACCCATAATACCACCGCTCAAAACGAATCGTTTCCATCAGTTTTGCCCGTCCCCCGAGTCAATGATAT
TTACCCTAATCGTGTTCCTGAGGTTGTGCGCTACGACCGCTATACCTTGGTCAGCAGTCGGCCTATTGAT
GCTCAGCGTGATCCGTTGAATCAAATGGTGGACATCACTATGCCTGCTAAAATGGTTCGCTCAGTGGGTG
ATGGTTTTCGCTATGTATTGCTGGAGTCTGGGTACTCACTGTGTTCGATATCATCATCGGTTTTCACCGA
ACTGCTAAACAAACCATTACCTGGTGTTCAACGTTCGATTGGGCCGTTACGTCTCAGTGATGCTTTGCAA
ATTCTTGCTGGCCCCGCATGGCGTTTGCGGGTTGATGATGTGAATCGGGAAGTCTGTTTTACGTTGCGTG
ATGCCTATCAGAACCTTGCTGTAGCCAAACCGCTAGTGCCAGCCAAGGTAATCATCCCAGCTAAAAATCT
AACGCACCAATCTGGAAACTTCTTATCTGGTTCATCCACTACCACGGTAGCACCTGTCATTGCTACACCT
TTAGTTCCGCTTAAATCGACGTTAAAGCCTGAAAATATTCCTGTGCCTTCTCCGGTAATCACCCCCGTGG
GCCAGCTTTGGCGGGCTGAGGTTGGTTCAACACTCAAAGAAACACTGAATCGTTGGGCGGGGCAGGCCAA
ATGTACTAACGGGGGCAACTGGGTGGTGATCTGGCCGGTTTTATTGGATTACCGCATTGATGCACCATTG
GCCTTCCACGGTAATTTTGAATCTGTACTGGTTCAGATTTTTGAGCTTTATCGCCAGGCAGATAAACCCT
TGTTTGCACAAGCCAGCCGACTGCAATGTCTGGTTGCGGTTAGCGATATCCCCGGAGGGCGCTAA
 Primer design