SecReT4
Protein ID: 124262888
T4SS name [ID]Tra_F [594]
Gene symboltraW
Locus tagMpe_B0348
StrainMethylibium petroleiphilum PM1
Repliconplasmid RPME01 [GenBank: NC_008826] [Browse all T4SS(s) in this replicon]
Location [Strand]300274..300966 [+]
Productsex pilus assembly protein
Component typeTraW_F
UniProt IDA2SNI4
KEGG IDmpt:Mpe_B0348
PDB IDNA
Domain hit(s) vs Pfam TraW_N [PF12477], Evalue: 2.2e-10, Aligned region: 18..46
Protein Sequence: 230 a.a.     [Download]
>gi|124262888|ref|YP_001023358.1| sex pilus assembly protein [Methylibium petroleiphilum PM1]
MPILSRSWADPARLIFVTAVHAAVFLLAAPSATAQQLGVYGNVWEIREPDAIDALKGKLTQMEKKGELKR
MWENYRDRYVASIENPAPIRGISKATAPAVRTFDPSVVFGDDVTDPSSGKLLVKAGTRVNPLDYTPLTKA
LIFIDGRDPAQVAFAKARSDANPRDKVILVAGSFLELNRKWGRVTYFDQRGHLTTRFGIKRVPAVVSQKG
RALQIEEFANLPAATPVVKK
 
Nucleotide Sequence: 693 bp     [Download]
>gi|124262546|ref|NC_008826.1|:300274-300966 Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence
ATGCCGATCCTGAGTCGCAGCTGGGCTGACCCGGCTCGCCTGATCTTCGTGACCGCGGTGCATGCCGCGG
TCTTTCTTCTGGCCGCGCCGTCAGCCACTGCGCAGCAGCTGGGCGTCTACGGCAACGTCTGGGAGATCCG
AGAGCCCGATGCGATCGACGCGCTGAAGGGCAAGCTCACCCAGATGGAGAAGAAGGGCGAGCTCAAGCGC
ATGTGGGAAAACTACCGGGACCGCTACGTGGCCTCGATCGAGAACCCGGCGCCGATCCGCGGCATCAGCA
AGGCGACGGCGCCGGCTGTGCGCACCTTCGATCCTTCCGTCGTCTTCGGCGATGACGTGACCGACCCGAG
CAGCGGCAAGCTGCTGGTCAAGGCCGGCACGAGGGTCAACCCGCTGGACTACACGCCGCTGACGAAGGCC
CTGATCTTCATCGACGGTCGCGACCCGGCCCAAGTCGCCTTCGCCAAGGCCCGCTCCGACGCCAATCCGC
GCGACAAGGTGATCCTGGTGGCCGGCTCGTTCCTCGAGCTGAACCGGAAGTGGGGCCGCGTGACGTACTT
CGACCAGCGCGGCCACCTGACCACGCGCTTCGGCATCAAGCGTGTGCCGGCAGTGGTCAGCCAGAAGGGC
CGCGCGCTGCAGATCGAAGAGTTCGCCAACCTGCCTGCCGCGACGCCGGTCGTGAAGAAGTGA
 Primer design