SecReT4
Protein ID: 124262889
T4SS name [ID]Tra_F [594]
Gene symboltraU
Locus tagMpe_B0349
StrainMethylibium petroleiphilum PM1
Repliconplasmid RPME01 [GenBank: NC_008826] [Browse all T4SS(s) in this replicon]
Location [Strand]300963..302024 [+]
Productconjugal DNA transfer protein
Component typeTraU_F
UniProt IDA2SNI5
KEGG IDmpt:Mpe_B0349
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 2.1e-70, Aligned region: 40..349
Protein Sequence: 353 a.a.     [Download]
>gi|124262889|ref|YP_001023359.1| conjugal DNA transfer protein [Methylibium petroleiphilum PM1]
MTYMFRINIKPLRSAAMAVLAAVAAIASSPASADSMCQGSFPNLITDVCWSCTFPLKLFGQAAFDSAGGE
DYASSDKTSVCTCKSPPTVGIPTSFWELNQMTDVTTTPGCFPMLGGAKVNVGVNADAYGHNGNNEQGGMA
QARESFRQVNLYINPAMYIMGAVLDNSCMDNRGIDIPWVSFADPTHNDEELANILTPYAFPFGSMVAIGA
MSADAVAATAGFPIPEIFWAAGSFGPMYPLTGTNQAHLSNEQSARLQTTRVLAKLHAAGTQWAAAGNDAM
CSYYPQIIMDKRQYKLQRLYPRPQTEKINGKCCDPIGRTTILTESGTEAPLSTFRDFGYAIFRKRDCCSG
AFP
 
Nucleotide Sequence: 1062 bp     [Download]
>gi|124262546|ref|NC_008826.1|:300963-302024 Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence
GTGACCTACATGTTCCGCATCAACATCAAGCCTCTGCGCAGCGCCGCCATGGCGGTGCTGGCCGCCGTCG
CCGCCATCGCATCGAGTCCGGCTTCCGCTGACTCTATGTGCCAGGGCAGCTTCCCCAACCTGATCACGGA
CGTCTGCTGGTCGTGCACGTTCCCGCTGAAGCTGTTCGGCCAGGCGGCGTTCGACAGCGCTGGCGGCGAG
GACTACGCGTCCTCCGACAAGACGTCGGTGTGCACCTGCAAGAGCCCGCCCACGGTCGGCATCCCGACGA
GCTTCTGGGAGCTCAACCAGATGACGGACGTGACCACCACGCCCGGCTGCTTCCCCATGCTCGGTGGAGC
GAAGGTGAACGTGGGCGTGAACGCCGACGCCTATGGTCACAACGGCAACAACGAGCAGGGTGGCATGGCC
CAGGCACGCGAGTCGTTTCGCCAGGTCAACCTGTACATCAACCCCGCGATGTACATCATGGGTGCCGTGC
TGGACAACTCCTGCATGGACAACCGCGGCATCGACATCCCGTGGGTGAGCTTCGCGGACCCGACGCACAA
CGACGAAGAGCTCGCGAACATCCTGACCCCGTACGCGTTCCCGTTCGGCTCGATGGTCGCGATCGGCGCC
ATGTCGGCCGATGCTGTCGCAGCCACCGCGGGCTTTCCGATCCCGGAGATCTTCTGGGCGGCGGGTTCGT
TCGGCCCGATGTACCCGCTAACAGGCACGAACCAGGCGCACCTTTCGAATGAGCAGTCCGCGCGCCTGCA
GACCACGCGCGTGCTGGCCAAGCTGCATGCCGCCGGCACGCAGTGGGCGGCCGCGGGCAACGACGCGATG
TGCAGCTACTACCCACAGATCATCATGGACAAGCGCCAGTACAAGCTGCAGCGCCTGTACCCGCGTCCGC
AGACGGAGAAGATCAACGGCAAGTGCTGCGACCCCATCGGCCGTACCACCATCCTCACCGAGTCGGGCAC
GGAAGCCCCGCTCTCCACCTTCAGGGACTTTGGCTATGCGATTTTCCGCAAGCGCGATTGCTGTTCTGGC
GCTTTCCCTTGA
 Primer design