SecReT4
Protein ID: 124262901
T4SS name [ID]Tra_F [594]
Gene symboltraG
Locus tagMpe_B0361
StrainMethylibium petroleiphilum PM1
Repliconplasmid RPME01 [GenBank: NC_008826] [Browse all T4SS(s) in this replicon]
Location [Strand]311837..313606 [-]
Productsex pilus assembly and mating pair formation
Component typeTraD_F
UniProt IDA2SNJ7
KEGG IDmpt:Mpe_B0361
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 5.4e-17, Aligned region: 97..259
TrwB_AAD_bind [PF10412], Evalue: 5.4e-17, Aligned region: 358..522
TraG-D_C [PF12696], Evalue: 4.5e-11, Aligned region: 377..511
AAA_10 [PF12846], Evalue: 6.8e-09, Aligned region: 107..454
Protein Sequence: 589 a.a.     [Download]
>gi|124262901|ref|YP_001023371.1| sex pilus assembly and mating pair formation [Methylibium petroleiphilum PM1]
MSFASMYRAKIGGTVDTLAMTALGAGAILSSPAFVESGGKLSFLMAAAGAAHLGRRFLQPWEEANALASK
INVRSADMLSSPDGLLLGYRTDTGDPVYIPDEDLMRHGLIGGQSGVGKTVLGKLLMYQQIQRGGGLAFVD
GKMNAEDIETIYQYCCLCGREQDLLILNPGNPGMSHSYNPILRGDPDEIAARVLSLIPSTENNPGADHYR
QSANQGLTTLVAALQEAGLAFNFIDLTILLMNHKAIEELESRLKRSKGGSAATKNLSLFLEQYKGGGKPG
SGLENMVDIKRMKETFGGVGGRMFQFGTGKFGEVLNTYSPEIDLFEAIRQNKIIYVALPTMGKNEAAGNM
GKMFLGDLRTAISWVQALPEDQKPRIPFLAFMDELGSYAVASLARPFEQARSARIALFPAFQTLANLEVV
SPDFAQMVLGNTWTKIFFKLGTQETAEPVADLIGKEMQIARSMTHTNNRSENNPLLAVAPEGGEGEGMGV
SEGEREEERHRVSPEDLKALDKGECVVLYGGDAVFNIRVPMIYVDPEVAREIGPLRIHHRRERQVEGADY
FKNSDRYLGGNSVPSGHRKQTAQEMLADE
 
Nucleotide Sequence: 1770 bp     [Download]
>gi|124262546|ref|NC_008826.1|:c313606-311837 Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence
ATGTCGTTTGCATCGATGTACCGCGCCAAGATCGGCGGCACGGTGGACACGTTGGCGATGACCGCGCTGG
GCGCGGGAGCCATCCTGTCGTCGCCGGCGTTCGTCGAGTCCGGGGGCAAGCTGTCGTTCCTCATGGCGGC
GGCCGGCGCCGCGCACCTCGGGCGGCGCTTCCTGCAGCCGTGGGAGGAGGCCAACGCCCTCGCCTCAAAG
ATCAACGTCCGCTCGGCCGACATGCTGTCCAGCCCGGACGGCCTGCTGCTGGGCTACCGGACCGACACCG
GCGATCCGGTCTATATCCCCGACGAAGACCTGATGCGGCACGGCCTGATCGGCGGCCAGTCGGGTGTCGG
CAAGACGGTGCTCGGCAAGCTGTTGATGTACCAGCAGATCCAGCGCGGCGGCGGCCTGGCGTTCGTCGAC
GGCAAGATGAACGCCGAAGACATCGAGACGATCTACCAGTATTGCTGCCTGTGCGGCCGCGAGCAGGATC
TGCTCATCCTGAACCCGGGCAATCCGGGCATGAGCCACTCCTACAACCCGATCCTGCGCGGCGACCCGGA
CGAGATCGCGGCGCGCGTGCTCTCGCTCATCCCCTCGACCGAGAACAACCCCGGCGCCGACCACTACCGC
CAGTCGGCCAACCAAGGCCTGACCACGCTGGTCGCAGCGCTGCAGGAGGCCGGCCTGGCCTTCAACTTCA
TCGACCTGACCATCCTGCTGATGAACCACAAGGCCATCGAGGAGCTGGAGTCGCGGCTGAAGCGCAGCAA
GGGCGGCTCGGCGGCGACGAAGAACCTCAGCCTGTTCCTCGAGCAGTACAAGGGCGGCGGCAAGCCCGGC
AGCGGCCTGGAGAACATGGTCGACATCAAGCGCATGAAGGAGACCTTCGGCGGCGTCGGCGGCCGGATGT
TCCAGTTCGGCACGGGCAAGTTCGGCGAGGTGCTCAACACCTACTCGCCGGAGATCGATCTGTTCGAGGC
GATCCGCCAGAACAAGATCATCTACGTGGCCCTGCCGACCATGGGCAAGAACGAGGCGGCGGGCAACATG
GGCAAGATGTTCCTGGGCGATCTGCGCACGGCGATCTCCTGGGTGCAGGCGCTGCCGGAAGACCAGAAGC
CCCGGATCCCGTTCCTGGCCTTCATGGACGAGCTCGGCTCGTACGCAGTCGCATCGCTGGCGCGCCCGTT
CGAGCAGGCGCGCTCGGCGCGGATCGCCCTCTTCCCGGCTTTCCAGACGCTGGCCAACCTGGAGGTCGTG
TCCCCCGACTTCGCCCAGATGGTGCTGGGCAACACCTGGACCAAGATCTTCTTCAAGCTGGGCACGCAGG
AGACCGCCGAACCGGTGGCCGACCTGATCGGCAAGGAGATGCAGATCGCGAGGTCGATGACGCACACGAA
CAACCGCAGCGAGAACAACCCGCTGCTGGCCGTGGCGCCGGAGGGCGGGGAAGGCGAAGGCATGGGCGTG
TCCGAGGGTGAGCGCGAGGAAGAGCGCCACCGCGTCAGCCCCGAAGACCTGAAGGCGCTGGACAAGGGCG
AGTGCGTAGTCCTGTACGGCGGCGATGCCGTCTTCAACATCCGCGTGCCGATGATCTACGTCGACCCCGA
GGTCGCGCGCGAGATCGGGCCGCTTCGCATTCACCACCGGCGCGAGCGCCAGGTCGAAGGCGCCGACTAC
TTCAAGAACAGCGATCGGTACCTGGGCGGCAACTCCGTTCCGTCCGGGCACCGCAAGCAGACGGCTCAGG
AAATGCTGGCCGACGAGTAA
 Primer design