SecReT4
Protein ID: 124262904
T4SS name [ID]Tra_F [594]
Gene symbol-
Locus tagMpe_B0364
StrainMethylibium petroleiphilum PM1
Repliconplasmid RPME01 [GenBank: NC_008826] [Browse all T4SS(s) in this replicon]
Location [Strand]315324..315608 [+]
Productpilus assembly protein
Component typeTraL_F
UniProt IDA2SNK0
KEGG IDmpt:Mpe_B0364
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 1.6e-12, Aligned region: 3..73
Protein Sequence: 94 a.a.     [Download]
>gi|124262904|ref|YP_001023374.1| pilus assembly protein [Methylibium petroleiphilum PM1]
MKEVEIPRYVDAQPQIFFWELDEAIVYVSCMAAGIFIGGMFTPISMVVGWFVVKLFKRFKNGSLEGVLLH
ICYRAGLLGLNKRYRDAMKRDFFL
 
Nucleotide Sequence: 285 bp     [Download]
>gi|124262546|ref|NC_008826.1|:315324-315608 Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence
GTGAAGGAAGTCGAAATCCCTCGCTACGTCGACGCCCAGCCCCAGATCTTCTTCTGGGAGCTCGACGAGG
CGATCGTCTACGTCTCCTGCATGGCGGCCGGCATCTTCATCGGCGGCATGTTCACGCCGATCTCCATGGT
CGTGGGTTGGTTCGTCGTGAAGCTGTTCAAGCGCTTCAAGAACGGCTCGCTCGAGGGCGTGTTGCTGCAC
ATCTGCTACCGCGCCGGCCTGCTTGGCCTGAACAAGCGCTACCGGGACGCGATGAAGCGCGACTTCTTCC
TGTAG
 Primer design