SecReT4
Protein ID: 124262905
T4SS name [ID]Tra_F [594]
Gene symboltraE
Locus tagMpe_B0365
StrainMethylibium petroleiphilum PM1
Repliconplasmid RPME01 [GenBank: NC_008826] [Browse all T4SS(s) in this replicon]
Location [Strand]315663..316304 [+]
Productsex pilus assembly protein
Component typeTraE_F
UniProt IDA2SNK1
KEGG IDmpt:Mpe_B0365
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 3.6e-15, Aligned region: 1..178
Protein Sequence: 213 a.a.     [Download]
>gi|124262905|ref|YP_001023375.1| sex pilus assembly protein [Methylibium petroleiphilum PM1]
MNLKNMTKTWQAANKVAALMLVSNVALAAALLVSIVAFSGNRERVVLVPPHLEKRVSVGWNTADAEYLKG
FGTYFAMLTANVTPKSASFVADTLSSAVSPAIYPEVRKQVLVLAKDPVFQKSGASVRFDPIQVEYEAATN
KVFVVGEITTNDATGRISRVQSVYEMEIRMDNGRPQVTAMASYAGADPHTLQWIENNKERLAEQQAQADA
TKE
 
Nucleotide Sequence: 642 bp     [Download]
>gi|124262546|ref|NC_008826.1|:315663-316304 Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence
ATGAACCTGAAGAACATGACCAAGACCTGGCAGGCGGCGAACAAGGTCGCCGCTCTGATGCTGGTTTCGA
ACGTCGCTCTGGCGGCGGCGCTGCTCGTTTCGATCGTCGCCTTCTCCGGCAATCGTGAGCGCGTGGTGCT
CGTGCCGCCGCACCTGGAGAAGCGCGTGTCGGTGGGCTGGAACACCGCGGACGCGGAGTACCTGAAGGGC
TTCGGCACGTACTTCGCGATGCTGACCGCGAACGTCACGCCCAAGAGCGCTTCCTTCGTGGCGGACACGC
TGTCGAGCGCGGTCTCGCCGGCGATCTACCCGGAGGTGCGTAAGCAGGTCCTGGTGCTGGCCAAGGATCC
CGTGTTCCAGAAGTCCGGCGCGTCGGTCCGCTTCGACCCTATCCAGGTGGAGTACGAGGCGGCCACCAAC
AAGGTCTTCGTCGTGGGTGAGATCACGACGAACGACGCGACGGGCCGAATCAGCCGCGTCCAGAGCGTCT
ACGAGATGGAGATCCGCATGGACAACGGCCGGCCTCAGGTCACCGCCATGGCTTCGTACGCCGGTGCCGA
CCCGCACACGCTCCAGTGGATCGAGAACAACAAGGAGCGCCTGGCTGAACAGCAGGCGCAGGCCGACGCA
ACCAAGGAATGA
 Primer design