SecReT4
Protein ID: 124262906
T4SS name [ID]Tra_F [594]
Gene symboltraK
Locus tagMpe_B0366
StrainMethylibium petroleiphilum PM1
Repliconplasmid RPME01 [GenBank: NC_008826] [Browse all T4SS(s) in this replicon]
Location [Strand]316301..317218 [+]
Productsex pilus assembly protein
Component typeTraK_F
UniProt IDA2SNK2
KEGG IDmpt:Mpe_B0366
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 3.4e-18, Aligned region: 87..296
Protein Sequence: 305 a.a.     [Download]
>gi|124262906|ref|YP_001023376.1| sex pilus assembly protein [Methylibium petroleiphilum PM1]
MSPVKNVFAVTLASVALSAVAQTLPPPPVVAAPKSAAPVVAAPKSAAPVVAKAAVKAPPVDDKLVKRVVE
QPLPGLGVMPGEKQLSRANVIRVQSDRNEIAYVSSSMANRISTPFDAPRVIDTQDVEYQTVGQSIYLLPK
DPEKPVALYITGSNANDPVVSLTLVPKPIPQQTIVLQIDAPLAKGGVTGVDSEPAPVTDVYSERLRYLLR
QVALNKVPEGFAEGTLPNAAAVLPGVSIHPMTRYSGPAYDIYRYRIRGTGDQVELAEDAFYTEGVRAVAF
FPTAVIRKGEETTIFVVADKRATEN
 
Nucleotide Sequence: 918 bp     [Download]
>gi|124262546|ref|NC_008826.1|:316301-317218 Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence
ATGAGCCCCGTGAAGAATGTCTTTGCCGTCACGCTGGCGTCGGTAGCGCTGAGCGCCGTCGCCCAAACCC
TCCCGCCGCCGCCGGTGGTCGCCGCGCCGAAGTCGGCCGCACCGGTGGTCGCCGCGCCGAAGTCGGCCGC
ACCGGTGGTCGCCAAAGCTGCCGTCAAGGCGCCCCCCGTGGACGACAAGCTCGTGAAGCGCGTTGTCGAG
CAGCCGTTGCCCGGCCTGGGTGTGATGCCCGGCGAGAAGCAGCTGTCCCGCGCCAACGTGATCCGCGTCC
AGTCCGATCGCAACGAGATCGCCTACGTGAGCTCGTCCATGGCCAACCGAATCTCGACGCCGTTCGACGC
GCCTCGCGTGATCGATACCCAGGACGTGGAATATCAGACCGTGGGTCAGTCGATCTACCTCCTGCCCAAG
GACCCCGAGAAGCCGGTTGCGCTCTACATCACGGGCTCGAACGCGAACGACCCCGTCGTCTCGCTCACGC
TGGTGCCCAAGCCCATCCCGCAGCAGACCATCGTGCTGCAGATCGATGCGCCGCTGGCCAAGGGGGGTGT
CACGGGCGTCGACTCGGAGCCTGCTCCGGTGACCGACGTCTACAGCGAGCGCCTGCGCTACCTGCTGCGT
CAGGTCGCCTTGAACAAGGTTCCCGAGGGGTTCGCCGAGGGCACGCTGCCCAACGCGGCCGCCGTGCTGC
CGGGCGTTTCGATCCACCCGATGACCCGCTACTCGGGGCCGGCCTATGACATCTACCGCTATCGCATTCG
CGGCACGGGTGATCAGGTGGAGCTCGCTGAGGACGCCTTCTACACCGAAGGTGTGCGTGCTGTCGCCTTC
TTCCCGACCGCGGTGATCCGCAAGGGCGAAGAGACCACGATCTTCGTGGTCGCGGACAAGCGCGCGACGG
AGAACTGA
 Primer design