SecReT4
Protein ID: 124262907
T4SS name [ID]Tra_F [594]
Gene symboltraB
Locus tagMpe_B0367
StrainMethylibium petroleiphilum PM1
Repliconplasmid RPME01 [GenBank: NC_008826] [Browse all T4SS(s) in this replicon]
Location [Strand]317220..318428 [+]
Productsex pilus assembly protein
Component typeTraB_F
UniProt IDA2SNK3
KEGG IDmpt:Mpe_B0367
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 6.1e-41, Aligned region: 198..401
Protein Sequence: 402 a.a.     [Download]
>gi|124262907|ref|YP_001023377.1| sex pilus assembly protein [Methylibium petroleiphilum PM1]
MLPKSIKDFWVTAGPKKRNMVLMAGAAFAMIVVATVMDSGSSKGGPARKSPVDTSRTQLMLPKAPDNSVE
ALAADSRAQSEQLTRLQEQLKKETADKELLLKRLDEGDRGRKPDAVTTDLLNEVVALKTKIQEIETRGAP
VAQAAASSPSLGDPLPGASVPMAEPPAPAEPVNRLRVSGEAKKIDRKAAVSEDKPVAYIPAGSFLEASLL
NGMDAPVSSVAQKNPVPAVMRVKTEAVLPNHFSQDVKECFVLVSGFGVLSSERVQLRTETISCVKEDGKA
IEAKIDGYVVGEDGSVGPRGRLVSKQGQLIARSLAAGVLAGFGEALTPQAVPQLSLSPSGTTPTTRLDAQ
TFAATGVARGFSDASKAVSGFFLEMAREATPVVEINAGRKLTIVVIKGFELK
 
Nucleotide Sequence: 1209 bp     [Download]
>gi|124262546|ref|NC_008826.1|:317220-318428 Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence
ATGCTGCCCAAGTCGATCAAGGACTTCTGGGTCACCGCAGGGCCCAAGAAGCGAAACATGGTGCTGATGG
CTGGAGCCGCCTTCGCGATGATCGTCGTCGCCACGGTGATGGACTCCGGTTCGTCGAAGGGTGGGCCGGC
GCGCAAGTCGCCCGTCGACACCAGCCGCACGCAGCTGATGCTTCCGAAGGCGCCGGACAACTCCGTCGAA
GCGCTTGCGGCGGACAGCCGCGCGCAATCCGAGCAGCTCACGCGTCTGCAGGAGCAGCTGAAGAAGGAGA
CGGCCGACAAGGAACTGCTGCTCAAGCGGCTGGACGAGGGTGATCGCGGCCGCAAGCCGGACGCAGTCAC
CACCGACCTGTTGAACGAGGTCGTTGCCCTCAAGACCAAGATCCAGGAAATCGAGACGCGTGGCGCTCCT
GTTGCCCAGGCTGCCGCTTCGTCGCCTTCGCTGGGCGACCCGCTTCCTGGCGCCAGCGTACCGATGGCGG
AGCCGCCGGCTCCGGCCGAGCCGGTCAACCGGTTGCGCGTCAGCGGCGAGGCCAAGAAGATCGATCGCAA
GGCCGCAGTCTCCGAAGACAAGCCGGTTGCCTACATCCCGGCCGGCTCGTTCCTGGAGGCCTCTCTCCTG
AACGGTATGGATGCGCCGGTTTCGTCGGTCGCGCAGAAGAACCCGGTGCCCGCGGTGATGCGAGTCAAGA
CCGAGGCGGTCCTGCCGAACCACTTTTCCCAGGACGTCAAGGAGTGCTTCGTCCTCGTGAGCGGCTTCGG
CGTGCTCAGCAGCGAACGCGTCCAACTGCGCACGGAGACGATCTCGTGCGTCAAGGAAGACGGCAAGGCC
ATCGAAGCCAAGATCGACGGCTACGTCGTCGGCGAAGACGGCAGTGTCGGACCTCGTGGCCGCCTCGTGA
GCAAGCAGGGCCAGCTGATCGCTCGCTCGCTGGCCGCTGGCGTGCTCGCGGGCTTCGGCGAGGCGCTGAC
TCCTCAGGCCGTTCCGCAGCTGAGCCTGTCGCCCAGCGGCACCACCCCGACCACTCGCCTCGACGCCCAG
ACCTTCGCGGCGACCGGCGTGGCGCGCGGCTTCTCCGATGCATCGAAGGCGGTCTCCGGCTTCTTCCTCG
AGATGGCGCGCGAAGCAACCCCTGTCGTCGAGATCAACGCCGGTCGCAAGCTGACGATCGTCGTCATCAA
GGGCTTCGAACTCAAGTAA
 Primer design