SecReT4
Protein ID: 124262909
T4SS name [ID]Tra_F [594]
Gene symboltraV
Locus tagMpe_B0369
StrainMethylibium petroleiphilum PM1
Repliconplasmid RPME01 [GenBank: NC_008826] [Browse all T4SS(s) in this replicon]
Location [Strand]318917..319609 [+]
Productsex pilus assembly protein
Component typeTraV_F
UniProt IDA2SNK5
KEGG IDmpt:Mpe_B0369
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 1.4e-24, Aligned region: 30..168
Protein Sequence: 230 a.a.     [Download]
>gi|124262909|ref|YP_001023379.1| sex pilus assembly protein [Methylibium petroleiphilum PM1]
MKGNPMRLLLAMGVTLLASGCGTILNTAGSDEYGCTPGEAKVTCRTPTAIYRSTNGSPPVAETDSPVAWS
KLIRGTSGALVEEQPDAAAPIPGVARSDASGGERRTPNERSVPGLNAQTLGLVGATIGGRPVREPAQVMR
IWIAPWIDKNDDLHYPSYLFTEVQARRWTFGKQAFAGRGVVVPHKDFASTDPQRSTASAAEQAPRGFAKP
ATPTAEPAEGSSSADFSLPN
 
Nucleotide Sequence: 693 bp     [Download]
>gi|124262546|ref|NC_008826.1|:318917-319609 Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence
ATGAAGGGTAATCCGATGCGTCTCCTGCTCGCGATGGGCGTCACGTTGCTGGCCAGCGGTTGCGGCACCA
TCCTCAACACGGCCGGTTCGGACGAGTACGGCTGCACTCCGGGCGAGGCGAAAGTCACCTGCCGAACGCC
GACCGCGATCTACCGCTCGACCAACGGTTCGCCGCCTGTTGCTGAGACCGATTCGCCGGTTGCCTGGAGC
AAACTGATCCGCGGCACGAGTGGCGCTCTGGTCGAAGAGCAGCCCGACGCCGCTGCCCCGATCCCGGGCG
TTGCGCGTTCAGACGCCTCCGGCGGTGAGCGCCGCACTCCCAACGAGCGCAGCGTTCCCGGCCTGAACGC
CCAGACGCTGGGCCTGGTGGGCGCCACCATCGGCGGCCGCCCGGTGCGCGAGCCTGCGCAGGTCATGCGC
ATCTGGATCGCGCCGTGGATCGACAAAAACGACGACCTGCACTACCCGAGCTACCTCTTCACCGAGGTGC
AGGCGCGTCGATGGACATTCGGCAAGCAGGCGTTCGCCGGTCGCGGCGTCGTCGTGCCCCACAAGGATTT
CGCGTCGACCGACCCGCAACGGTCGACTGCGAGCGCTGCGGAGCAAGCCCCTCGGGGTTTCGCCAAACCA
GCGACCCCCACGGCCGAACCGGCCGAGGGCTCCTCTTCCGCGGATTTCTCTCTCCCTAACTGA
 Primer design