SecReT4
Protein ID: 124262910
T4SS name [ID]Tra_F [594]
Gene symbol-
Locus tagMpe_B0370
StrainMethylibium petroleiphilum PM1
Repliconplasmid RPME01 [GenBank: NC_008826] [Browse all T4SS(s) in this replicon]
Location [Strand]319626..319937 [+]
Producthypothetical protein
Component typeTraA_F
UniProt IDA2SNK6
KEGG IDmpt:Mpe_B0370
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 103 a.a.     [Download]
>gi|124262910|ref|YP_001023380.1| hypothetical protein Mpe_B0370 [Methylibium petroleiphilum PM1]
MKFNLSTLSKRRLAVAAAALALAGVAVAGTATTGTNDFNSVTTRLTAWLEGSLGKTFALGSLGVGLAIGV
VKQSVMSVVTGVAVALAGSIGPAVLGGIFTATM
 
Nucleotide Sequence: 312 bp     [Download]
>gi|124262546|ref|NC_008826.1|:319626-319937 Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence
ATGAAGTTCAATCTCTCCACCCTGTCCAAGCGTCGCCTCGCGGTTGCCGCTGCCGCCCTGGCCCTCGCCG
GTGTCGCTGTCGCCGGCACCGCGACGACCGGTACCAACGACTTCAACTCCGTGACGACGCGCCTGACCGC
CTGGCTCGAAGGCTCGCTGGGCAAGACGTTCGCCCTCGGGTCGCTCGGCGTCGGCCTGGCCATCGGCGTC
GTGAAGCAGTCGGTCATGTCGGTGGTCACCGGTGTGGCTGTCGCGCTGGCGGGCTCGATCGGCCCGGCCG
TGCTCGGCGGCATCTTCACGGCGACGATGTAA
 Primer design