SecReT4
Protein ID: 124262911
T4SS name [ID]Tra_F [594]
Gene symboltraC
Locus tagMpe_B0371
StrainMethylibium petroleiphilum PM1
Repliconplasmid RPME01 [GenBank: NC_008826] [Browse all T4SS(s) in this replicon]
Location [Strand]320102..322531 [+]
ProductF-pilin subunit assembly into extended F pili
Component typeTraC_F
UniProt IDA2SNK7
KEGG IDmpt:Mpe_B0371
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 2.7e-60, Aligned region: 439..713
TraC_F_IV [PF11130], Evalue: 3.1e-44, Aligned region: 17..242
Protein Sequence: 809 a.a.     [Download]
>gi|124262911|ref|YP_001023381.1| F-pilin subunit assembly into extended F pili [Methylibium petroleiphilum PM1]
MFGFLRQERDNVPFANLTVMAHDPATRLFHMTDGEVSYLGACFVGDPLTGADQSTVDKFSSAFGMPFPAG
TFVQIGLLSTPDVDEYLDAYVGAKAQDGVLGALAARHRDLISSGREKPLVSRSGIYLHRQRLVITIKTPL
HNNRPTEADISSAKEYADRLQEALKASGLHMEALDAPRYVALMRLMTHPHDPIDDRYDAHKPIREQIFFP
GDSVSYDDKSTISFHDGKHFAKLLSVKHFPKRATLGLMNFIVGEPQGLSNQITEPYWITLTLHYPDQVKK
ADWVRGRSAMINHQVFGPTAHMIPVLGYKKAGIDTLVHEMEGRGAVLCDVNFSIFLISRDRSRLNKSIAG
LQAYYSSLAFEFREDSRILETMWDNLLPLNVSAPAIEKTFRFHTMAVSQAVCFLPIIGEWRGSGVGRSVL
MVTRRGQPALFDLYDSSTNYNGVVFAESGAGKSFFTQKLVSDYLAEGAKVWAIDVGHSYKKLCRSVGGEF
VEFHAESRICLNPFTNIDGNLDEEMDILKATIAKMAAPEESLSDYQMAILEQAITSVYTKFGNKANVIAI
VEFLMAQTDSEAHRLAKQLYPFAGGAYTRWFDGDNNLDLDNAFVVLELQDLKGRKALQQVVLLQLISRIN
HEIYRTHGRKKILIIDEAWELLDDPLMAKAMEAAYRKARKHDGAVLVVTQSLADLYNSPNSRAIVANSAW
QFILKQNGEAVDAAIDGGQFKIEPYGAYMLKTVHTVRGAYSEVMVKRGDNSWGILRLVVDRFTQVMFSTS
GAERDQILGAIDRGEDVVEAVDAYIASENDRAGRELEAA
 
Nucleotide Sequence: 2430 bp     [Download]
>gi|124262546|ref|NC_008826.1|:320102-322531 Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence
ATGTTTGGATTCCTGAGGCAAGAGCGGGACAACGTCCCATTCGCCAATCTCACTGTGATGGCGCATGACC
CAGCCACGCGGTTGTTTCACATGACCGACGGCGAGGTCAGCTATCTCGGCGCCTGCTTCGTTGGTGACCC
GCTGACCGGCGCAGACCAGTCGACCGTGGACAAGTTCAGCTCCGCCTTCGGAATGCCTTTCCCGGCCGGT
ACCTTCGTACAGATCGGCCTGCTGTCGACGCCCGACGTCGACGAGTATCTCGACGCCTACGTCGGCGCGA
AGGCGCAAGACGGCGTCCTCGGCGCTCTCGCTGCTCGCCACCGCGACCTCATCTCCTCGGGGCGCGAGAA
GCCGCTGGTATCGCGCTCGGGCATCTACCTGCACCGGCAGCGCCTGGTGATCACGATCAAGACGCCGCTC
CACAACAATCGACCGACCGAGGCCGACATCTCTTCGGCCAAGGAGTATGCCGACCGCCTGCAGGAAGCGC
TCAAGGCCTCCGGCCTGCACATGGAGGCCCTGGACGCGCCGCGCTACGTCGCGCTCATGCGCCTGATGAC
GCACCCTCACGACCCCATCGACGACCGCTACGACGCGCACAAGCCGATCCGCGAGCAGATCTTCTTCCCC
GGCGATTCGGTCAGCTACGACGACAAGTCGACGATCAGCTTCCACGACGGCAAGCACTTCGCCAAGCTGC
TGAGCGTGAAGCACTTCCCGAAGCGCGCAACGCTCGGGCTCATGAACTTCATCGTCGGAGAGCCGCAGGG
GCTGTCGAACCAGATCACGGAGCCCTACTGGATCACGCTGACGCTGCACTACCCCGACCAGGTCAAGAAG
GCCGACTGGGTGCGCGGCCGCTCGGCCATGATCAATCACCAGGTCTTCGGCCCGACGGCACACATGATCC
CGGTGCTCGGCTACAAGAAGGCAGGCATCGACACCCTGGTGCACGAGATGGAGGGACGTGGCGCGGTCCT
CTGCGACGTCAACTTCTCGATCTTCCTGATCTCACGAGACAGGAGCCGTCTCAACAAGTCGATCGCCGGC
CTGCAGGCCTACTACTCGTCGCTCGCCTTCGAGTTCCGCGAGGACAGCCGCATCCTCGAGACGATGTGGG
ACAACCTGCTGCCGCTGAACGTCAGTGCGCCGGCGATCGAGAAGACCTTCCGTTTCCACACCATGGCCGT
GTCGCAGGCCGTCTGCTTCCTGCCGATCATCGGCGAGTGGCGCGGCAGCGGCGTGGGCCGCTCGGTTCTG
ATGGTTACGCGACGCGGACAGCCGGCCCTGTTCGACCTCTACGATTCGTCGACCAACTACAACGGGGTCG
TGTTCGCCGAGTCCGGCGCCGGCAAGTCGTTCTTCACACAGAAGCTGGTCTCGGACTACCTGGCGGAGGG
CGCCAAGGTGTGGGCGATCGACGTCGGCCACAGCTACAAGAAGCTGTGCCGCTCGGTGGGTGGCGAGTTC
GTCGAATTCCACGCCGAGAGCAGGATCTGCCTCAACCCGTTCACGAACATCGACGGCAACCTGGACGAGG
AGATGGACATCCTCAAGGCGACCATCGCCAAGATGGCAGCGCCCGAGGAGTCGCTGTCCGACTACCAGAT
GGCCATCCTCGAGCAGGCGATCACCAGCGTCTACACGAAGTTCGGCAACAAGGCCAACGTCATCGCGATC
GTCGAGTTCCTGATGGCGCAAACGGACAGCGAGGCGCACCGCCTGGCGAAGCAGCTCTATCCGTTCGCAG
GCGGCGCCTACACGCGCTGGTTCGATGGCGACAACAATCTCGACCTCGACAACGCGTTCGTCGTGCTGGA
GCTCCAGGACCTCAAGGGCCGCAAGGCGCTCCAGCAAGTGGTGCTGCTGCAGCTCATCTCGCGCATCAAC
CACGAGATCTACCGCACGCACGGCCGCAAGAAGATCCTGATCATCGACGAGGCCTGGGAACTGCTGGACG
ACCCGCTTATGGCCAAGGCTATGGAAGCGGCCTATCGCAAGGCACGGAAGCACGACGGCGCTGTTCTGGT
CGTGACCCAGTCGCTGGCCGACCTGTACAACTCACCCAACTCGCGCGCGATCGTGGCGAACTCGGCCTGG
CAGTTCATCCTGAAGCAGAACGGCGAGGCCGTCGACGCGGCGATCGATGGTGGCCAGTTCAAGATCGAGC
CGTACGGCGCGTACATGCTGAAGACCGTGCACACCGTGAGGGGTGCCTACTCGGAGGTCATGGTCAAGCG
CGGCGACAACAGCTGGGGGATCCTGCGCCTCGTGGTCGACCGGTTCACCCAGGTCATGTTCTCGACCAGC
GGCGCCGAGCGTGATCAGATCCTCGGCGCAATCGATCGCGGGGAGGATGTCGTCGAGGCCGTGGATGCGT
ACATCGCCAGCGAGAACGATCGGGCCGGCAGAGAGCTGGAGGCCGCCTAA
 Primer design