SecReT4
Protein ID: 124262914
T4SS name [ID]Tra_F [594]
Gene symboltraF
Locus tagMpe_B0374
StrainMethylibium petroleiphilum PM1
Repliconplasmid RPME01 [GenBank: NC_008826] [Browse all T4SS(s) in this replicon]
Location [Strand]323651..324604 [+]
Productsex pilus assembly protein
Component typeTraF_F
UniProt IDA2SNL0
KEGG IDmpt:Mpe_B0374
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 1.6e-70, Aligned region: 44..263
Protein Sequence: 317 a.a.     [Download]
>gi|124262914|ref|YP_001023384.1| sex pilus assembly protein [Methylibium petroleiphilum PM1]
MTRFTLRFVWAALTLVVAAPALRAQDAAGGDDAPGRFIERKAEGWFWYKDPKDAPKPPAPKASAPAAARS
AQPADASQEPFSAKWLQQNMPKLLEAAIDNPTKENVEAYLYAQRVAMDKSQTYAEKARSVVASDPFLDEN
NRVPLSTYAKPSFLKGVESAKTDALKHLTTVGGLWVFFDSKCEFCRPQIFSVQELARKHGFYTKFISLDG
VGVPELKTFEKDNGHAKLLNLKLTPTTVLVVPPNNYYVVSQGMMSESQLADRLVLAAESQNLLPKDVASK
VRTYDRGVLSAEDTQQGAGSNPKDWVQYLKDKLQGRY
 
Nucleotide Sequence: 954 bp     [Download]
>gi|124262546|ref|NC_008826.1|:323651-324604 Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence
ATGACTCGCTTCACGCTTCGTTTCGTCTGGGCAGCGCTGACTCTTGTCGTCGCCGCGCCCGCGCTGCGTG
CCCAGGATGCCGCCGGCGGCGATGACGCGCCCGGCCGCTTCATCGAGCGCAAGGCGGAGGGGTGGTTTTG
GTACAAGGACCCGAAGGACGCCCCGAAACCTCCGGCGCCAAAGGCCTCCGCTCCGGCGGCTGCCAGGAGC
GCGCAGCCGGCGGACGCCAGCCAGGAGCCGTTCTCGGCCAAGTGGCTGCAGCAAAACATGCCGAAGCTGC
TCGAGGCTGCCATCGACAACCCCACCAAGGAAAACGTCGAGGCCTACCTATACGCGCAGCGCGTTGCGAT
GGACAAGTCGCAGACCTACGCCGAGAAGGCGCGCAGCGTGGTGGCCAGCGACCCATTCCTCGACGAGAAC
AACCGCGTCCCGCTGTCGACCTACGCGAAGCCCTCCTTCCTGAAAGGTGTGGAGTCCGCGAAGACCGATG
CGCTCAAGCACCTGACGACCGTTGGAGGTCTCTGGGTGTTCTTCGACTCGAAGTGCGAGTTCTGCCGGCC
GCAGATCTTCTCGGTGCAGGAGCTCGCGCGCAAGCACGGCTTCTACACCAAGTTCATCTCCCTGGACGGC
GTCGGCGTGCCGGAGCTGAAGACCTTCGAGAAGGACAACGGCCACGCCAAGCTGCTCAACCTGAAGCTGA
CACCCACCACCGTCCTGGTCGTTCCGCCGAACAACTACTACGTGGTCTCGCAGGGAATGATGTCCGAAAG
CCAGCTCGCCGATCGCCTTGTGCTCGCGGCTGAGTCGCAGAACCTGCTCCCCAAAGACGTCGCCTCCAAG
GTCCGCACGTATGACCGCGGCGTCCTTTCAGCAGAGGACACGCAGCAGGGTGCCGGATCCAACCCCAAAG
ACTGGGTGCAGTACCTCAAGGACAAGCTGCAGGGCCGCTACTGA
 Primer design