SecReT4
Protein ID: 124262915
T4SS name [ID]Tra_F [594]
Gene symboltraH
Locus tagMpe_B0375
StrainMethylibium petroleiphilum PM1
Repliconplasmid RPME01 [GenBank: NC_008826] [Browse all T4SS(s) in this replicon]
Location [Strand]324628..326073 [+]
Productsex pilus assembly protein
Component typeTraH_F
UniProt IDA2SNL1
KEGG IDmpt:Mpe_B0375
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 3.9e-105, Aligned region: 27..413
Protein Sequence: 481 a.a.     [Download]
>gi|124262915|ref|YP_001023385.1| sex pilus assembly protein [Methylibium petroleiphilum PM1]
MKINLRILAAATALAASLFASPAHAGLQDALDGMFMSNSTAPQAFSSQSRGGFVGGSVAMRTPVRNINLV
AFDPPRLAAGCGGIDMFGGSFSFINADQLVALFRQIAANSVGLAFKAAIDYINPALGKQMQEFQAKMQAL
NENMRNTCAIANQVVKSFSDPSARKDMVDGATAAAEAAKGGFDDLWSGMTSFFTTPNSATRTADAGGYCA
ECGNPVWKALVSSNSGVLLGDPTTSTDSNANRTNEIIMSLMGTVIMSTTKADTTTTGGVTQKDTGTVKPY
LLTLFDLRDGSSSGKPFKIWTCSDGYAKHQCTQLTETAVTFDGMKGYVNKMLFGYADGLASGVPTAGSII
GKLESCSTTSCGFTQAQKDFLNSVQTPTLALVRKVQAVPGASQHVATRLVDQIANEIAVKYGEAAVRAIR
MSFTEGKFPKPPEIVEAEKQRLAELSELRQENTKLTEQTMAVRAYVAAVVSDNPAVFARIK
 
Nucleotide Sequence: 1446 bp     [Download]
>gi|124262546|ref|NC_008826.1|:324628-326073 Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence
ATGAAGATCAACCTCCGCATCCTTGCCGCCGCGACCGCCCTGGCGGCTTCGCTTTTTGCCAGCCCTGCGC
ATGCCGGCCTCCAAGACGCACTCGACGGCATGTTCATGTCGAACTCGACCGCGCCACAAGCCTTCTCCTC
GCAGTCGCGAGGCGGCTTCGTCGGCGGCAGCGTCGCAATGCGCACCCCGGTGCGCAACATCAATCTGGTC
GCGTTCGATCCGCCGCGCCTGGCGGCCGGCTGCGGCGGCATCGACATGTTCGGCGGCTCGTTCTCGTTCA
TCAACGCGGACCAGCTGGTGGCGCTGTTCCGGCAGATCGCAGCGAACTCGGTCGGCCTGGCCTTCAAGGC
GGCGATCGACTACATCAACCCGGCGCTCGGCAAGCAGATGCAGGAGTTCCAGGCCAAGATGCAGGCGCTG
AACGAGAACATGCGCAACACCTGCGCGATCGCCAACCAGGTGGTCAAGAGCTTCAGCGACCCGTCCGCGC
GCAAGGACATGGTTGACGGCGCGACCGCGGCCGCGGAAGCGGCCAAGGGCGGCTTCGACGACCTGTGGAG
CGGCATGACCAGCTTCTTCACGACCCCCAACAGCGCGACGCGCACGGCAGACGCTGGCGGCTATTGCGCG
GAATGCGGCAACCCTGTCTGGAAGGCGCTCGTATCGAGCAATTCCGGTGTGCTGCTGGGTGACCCGACGA
CGTCGACCGACTCAAACGCGAATCGGACGAACGAGATCATCATGAGCCTGATGGGCACGGTGATCATGAG
CACCACCAAGGCCGACACGACAACGACTGGTGGAGTGACGCAGAAGGACACCGGCACCGTCAAGCCGTAC
TTGCTCACTTTGTTCGATCTTCGTGACGGATCCAGTTCCGGCAAGCCGTTCAAGATCTGGACCTGTTCGG
ACGGCTACGCGAAGCACCAGTGCACGCAGCTGACCGAGACGGCTGTGACGTTCGACGGCATGAAGGGCTA
CGTCAACAAGATGCTCTTCGGCTACGCGGACGGCCTGGCCAGCGGTGTTCCGACCGCAGGCTCCATCATC
GGCAAGCTCGAGTCCTGCTCCACGACCAGCTGCGGCTTCACACAAGCCCAGAAGGATTTCCTCAACTCGG
TCCAGACGCCGACCTTGGCGCTGGTCCGCAAGGTGCAAGCGGTACCCGGTGCATCCCAACACGTCGCGAC
GCGTCTGGTCGACCAGATCGCCAACGAGATCGCTGTGAAGTACGGCGAGGCTGCGGTGCGCGCGATCCGC
ATGAGCTTCACCGAGGGCAAGTTCCCCAAGCCTCCCGAGATCGTCGAAGCCGAGAAGCAGCGCCTGGCCG
AGCTCTCCGAACTGCGCCAAGAGAACACCAAGCTGACTGAGCAGACGATGGCGGTACGCGCCTATGTGGC
TGCGGTCGTCTCCGACAACCCGGCCGTATTCGCGCGCATCAAGTGA
 Primer design