SecReT4
Protein ID: 124262916
T4SS name [ID]Tra_F [594]
Gene symbol-
Locus tagMpe_B0376
StrainMethylibium petroleiphilum PM1
Repliconplasmid RPME01 [GenBank: NC_008826] [Browse all T4SS(s) in this replicon]
Location [Strand]326090..329608 [+]
Producthypothetical protein
Component typeTraG_F
UniProt IDA2SNL2
KEGG IDmpt:Mpe_B0376
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 6.1e-89, Aligned region: 4..481
Protein Sequence: 1172 a.a.     [Download]
>gi|124262916|ref|YP_001023386.1| hypothetical protein Mpe_B0376 [Methylibium petroleiphilum PM1]
MNFSIYVLGEVGSFVAALNSVAMVLGSTDFLGGAALLGALVGLTAFLIFLVNKEAGQQLIQGGSPIVGLL
VFWVFVSSINIKTKVEITDVYTGNTSVVDNVPALLSMPASAISTAAYKIFDFSNTAFQGVDGSFMALGET
GYVMPLQILNSLRQGMESVDPLLAASTKQFIVDCVPGGTVNPESLAAAPDALDYIFTNARDNGLTTAFTA
AAPSGTSTSCVQAKASLAARSNDLLHTADSNLGGATKLEALVNTNVKSKNPNAGPIDGAMITDSVNRLIL
NSMTGSARQNADQFMLNVLFYNTMTSTFNCIDKSASQDAFSSCDVMMTQAAEQWKTDSAASASLFAKTMM
PAMVFMQLMFYSLAPIVIIFGLLRGAGAIGMYVKFLGFGVWTASWLPVAAVIQMYIQNNVAGKVAQITAR
AVTPGNLKSVYYDVISTNLAIASDMLAATPLVTATILGISGMAISQLANNMGGKDRVDEKLATPDLMKNS
PLAQRTSMAEQNANTGVVTQTGTPPLMMTHRAANSSAMASANATREADQKSIGADLSKGLNAAETRMLST
LNSVGAVRTEGDSVGFRTTDGHTISFGNAASSTAAQQALAKAAVSSQAGMEIGASIKAAIVPGMLKALAA
GGSKVKDAAGAEALLSGAAKDLATKDASFMSRLARGDEDAVGTLIDTAMTAGMIGATVVGTATTGVGGAA
AGLAVRGAAIAGRGAMIAGATKAIRGISSALEKGGTIATMTSAIFDNTQAGAKANMSAAISAAKELSGTT
AEQQQQMASDMTNWTRGDYVGHDVTNSKTRGTQRSDQSQRSTAAMISETFKAAEQRIQSSDQTYQRNAQQ
ALDAGVAWSGSAADFAALLRANPAMAADLRQRMAQMDGAIAGDVARARMLIDNQIKGGMTEDERNLAAGA
MALSAVDKSFNLVSGRDPSGLNADSNAGLPAPNIGDRISQAQREVPAAGTIVPQPVAATSAIGGTAYTQA
PVMPAQPAPQPAAPRHTAPVAAGAGSPAVRPVTAHAAPKHAAPAVPAAPAAPSMQELRDRHVQHRTDPAG
MAQLVNKDGPAAAGPQTPDIQKLNITDPMKQVLSSESGQTIATTVAAVTAVNALSGLGAGGRRGGGGAGG
AGGPGGAGGAGGSGGAPQAPGTPGQAHSGGGGSNPPPASRPGRKVPALFKRK
 
Nucleotide Sequence: 3519 bp     [Download]
>gi|124262546|ref|NC_008826.1|:326090-329608 Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence
ATGAACTTCAGCATCTACGTTCTCGGCGAAGTCGGCTCGTTTGTCGCCGCCCTCAACAGCGTGGCGATGG
TCCTGGGAAGCACCGACTTCCTCGGCGGCGCGGCTCTCCTCGGCGCCTTGGTTGGCCTGACGGCTTTCCT
GATCTTCCTGGTCAACAAGGAGGCTGGACAGCAGCTGATCCAAGGCGGCAGCCCCATCGTTGGTCTCCTG
GTGTTCTGGGTCTTCGTCTCATCGATCAACATCAAGACGAAGGTCGAGATCACCGATGTCTACACCGGAA
ACACAAGCGTCGTGGACAACGTCCCAGCGCTGCTCAGCATGCCGGCCTCGGCGATCAGCACCGCGGCCTA
CAAGATCTTCGACTTCTCGAACACTGCGTTCCAGGGCGTGGACGGCAGCTTCATGGCGCTCGGCGAGACC
GGCTATGTGATGCCCCTCCAGATCCTGAACTCGCTGCGTCAAGGCATGGAGAGCGTCGACCCTCTGCTCG
CGGCTTCCACGAAGCAATTCATCGTGGACTGCGTCCCCGGCGGCACGGTCAACCCCGAGTCGCTGGCAGC
GGCTCCGGATGCGCTCGACTACATCTTCACCAATGCCCGGGACAACGGGCTCACCACCGCCTTCACAGCG
GCAGCACCCTCGGGCACGTCGACCTCGTGCGTTCAGGCGAAGGCGTCTCTCGCGGCACGATCGAACGATC
TGCTGCACACCGCCGATTCCAATCTCGGAGGCGCCACGAAGCTCGAAGCGCTGGTCAACACCAACGTCAA
GTCGAAGAATCCGAACGCCGGCCCAATCGACGGGGCCATGATCACCGATTCGGTCAACCGCTTGATCCTG
AACTCGATGACCGGCTCCGCGCGCCAGAACGCTGACCAGTTCATGCTGAACGTGCTCTTCTACAACACGA
TGACCAGCACGTTCAACTGCATCGACAAGTCAGCCTCGCAGGACGCGTTCTCGTCGTGCGACGTCATGAT
GACGCAGGCCGCGGAGCAGTGGAAAACCGACTCCGCAGCGTCGGCGAGCCTCTTCGCCAAGACGATGATG
CCCGCGATGGTCTTCATGCAGCTGATGTTCTACAGCTTGGCTCCCATCGTCATCATCTTCGGTCTCCTCC
GTGGTGCCGGCGCCATCGGCATGTACGTCAAGTTCCTCGGCTTCGGTGTCTGGACTGCGTCGTGGCTCCC
CGTCGCAGCCGTGATCCAGATGTACATCCAGAACAACGTCGCCGGAAAGGTCGCGCAGATCACCGCGCGC
GCGGTGACCCCGGGCAACCTCAAGTCCGTCTACTACGATGTGATCAGCACGAACCTGGCGATCGCGTCCG
ACATGCTGGCCGCGACCCCCTTGGTGACCGCAACCATCCTCGGTATCTCCGGCATGGCGATCTCGCAGCT
CGCGAACAACATGGGCGGCAAGGATCGCGTCGACGAGAAGCTGGCCACGCCGGACCTCATGAAGAACTCG
CCTCTGGCGCAGCGCACCAGCATGGCTGAGCAGAACGCGAACACCGGCGTTGTCACGCAGACCGGTACGC
CGCCGCTGATGATGACGCACCGTGCCGCCAACTCGAGCGCGATGGCCAGCGCCAACGCAACCCGCGAGGC
GGATCAGAAGTCGATCGGCGCCGACCTGAGCAAGGGTCTGAACGCTGCGGAAACCAGGATGCTCTCGACG
CTCAACAGCGTCGGCGCTGTCAGGACCGAAGGCGACAGCGTTGGTTTCCGCACGACCGATGGCCACACGA
TCTCGTTCGGCAATGCCGCAAGCAGCACTGCGGCCCAGCAGGCATTGGCCAAGGCGGCGGTCAGCTCGCA
GGCCGGCATGGAGATCGGCGCAAGCATCAAGGCGGCCATCGTTCCTGGCATGTTGAAGGCCCTGGCCGCG
GGCGGCAGCAAGGTGAAGGACGCCGCCGGCGCCGAAGCGCTCCTTTCGGGCGCGGCCAAGGATCTGGCAA
CCAAGGATGCCTCGTTCATGTCGCGCTTGGCGCGCGGCGATGAGGATGCGGTTGGCACCCTGATCGACAC
GGCCATGACGGCGGGCATGATCGGTGCGACTGTGGTCGGAACGGCGACGACTGGTGTCGGCGGCGCTGCT
GCTGGCCTCGCGGTTCGCGGTGCGGCCATTGCAGGCCGTGGCGCAATGATCGCCGGCGCGACCAAGGCGA
TCCGCGGCATCAGCTCCGCACTGGAGAAGGGCGGAACGATCGCGACCATGACGTCCGCCATCTTCGACAA
CACGCAGGCAGGCGCGAAGGCGAACATGTCCGCCGCGATTTCGGCTGCCAAGGAGCTTTCCGGAACGACG
GCCGAGCAGCAGCAGCAGATGGCCTCGGACATGACGAACTGGACCCGCGGCGACTACGTCGGGCACGACG
TCACAAACTCCAAGACGCGTGGCACGCAACGGTCCGATCAGAGTCAGCGCTCGACTGCCGCAATGATCAG
CGAGACCTTCAAGGCTGCCGAGCAGCGGATTCAGTCGAGCGATCAGACCTACCAGCGCAACGCGCAGCAG
GCACTCGACGCTGGCGTCGCGTGGAGCGGCTCTGCGGCCGACTTCGCGGCGCTGCTGCGTGCCAACCCGG
CAATGGCTGCCGACCTGCGCCAGCGCATGGCGCAGATGGACGGCGCGATCGCTGGAGATGTCGCGAGGGC
TCGCATGCTCATCGACAACCAGATCAAGGGCGGCATGACGGAAGACGAGCGCAACCTCGCCGCCGGCGCC
ATGGCTCTGTCTGCGGTCGACAAGAGCTTCAATCTGGTGTCGGGTCGCGATCCGTCTGGGCTGAACGCCG
ACAGCAACGCCGGGCTGCCGGCGCCGAACATCGGGGATCGGATCTCCCAGGCTCAGCGCGAGGTGCCTGC
TGCAGGCACTATCGTCCCGCAGCCTGTCGCGGCCACGTCCGCCATCGGCGGCACGGCCTATACCCAGGCC
CCCGTGATGCCCGCTCAGCCGGCCCCGCAGCCAGCTGCGCCCAGGCACACCGCGCCCGTTGCCGCAGGCG
CTGGGTCGCCCGCCGTGCGCCCCGTGACGGCCCACGCGGCGCCGAAGCACGCCGCGCCTGCTGTACCCGC
CGCGCCCGCGGCGCCCTCGATGCAGGAACTGCGGGACCGGCACGTGCAGCATCGGACCGATCCGGCCGGC
ATGGCGCAGCTGGTGAACAAGGACGGACCGGCCGCCGCGGGCCCGCAGACGCCGGACATTCAGAAGCTCA
ACATCACCGACCCCATGAAGCAGGTCTTGAGCTCCGAATCTGGCCAGACGATCGCCACGACCGTGGCTGC
GGTGACCGCCGTCAACGCACTCTCCGGCCTCGGCGCCGGCGGTCGCCGTGGAGGGGGTGGCGCTGGCGGT
GCCGGCGGGCCTGGTGGCGCTGGCGGCGCTGGCGGCTCTGGCGGCGCGCCGCAGGCACCTGGCACTCCGG
GCCAGGCACATTCTGGCGGCGGCGGAAGCAATCCTCCCCCCGCCTCCAGGCCTGGCAGGAAGGTGCCGGC
GCTGTTCAAGAGGAAGTAG
 Primer design