SecReT4
Protein ID: 124262919
T4SS name [ID]Tra_F [594]
Gene symboliagB
Locus tagMpe_B0379
StrainMethylibium petroleiphilum PM1
Repliconplasmid RPME01 [GenBank: NC_008826] [Browse all T4SS(s) in this replicon]
Location [Strand]332481..332921 [-]
Productinvasion protein
Component typeOrf169_F
UniProt IDA2SNL5
KEGG IDmpt:Mpe_B0379
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 146 a.a.     [Download]
>gi|124262919|ref|YP_001023389.1| invasion protein [Methylibium petroleiphilum PM1]
MKRSTKALLAAAALAIAGQAHAMCFKEAAERYKVSEALLRAIAKTESNFNPKALNRNSNGTEDIGVMQIN
SSWLPTLAQFGIGREQLKDPCTNVNIGAWVLANNIARHGETWRAVGAYNAATPSKQVVYVEKVWLNSIKL
KKNGTP
 
Nucleotide Sequence: 441 bp     [Download]
>gi|124262546|ref|NC_008826.1|:c332921-332481 Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence
ATGAAACGATCAACCAAAGCCCTGCTCGCGGCCGCTGCCCTAGCCATTGCCGGCCAGGCGCACGCCATGT
GCTTCAAGGAGGCCGCTGAGCGATACAAGGTCAGCGAAGCGCTTCTGCGCGCCATCGCCAAGACCGAGTC
GAACTTCAACCCGAAGGCGTTGAACCGCAACAGCAACGGCACCGAAGACATCGGCGTCATGCAGATCAAC
TCGAGCTGGCTGCCGACACTCGCCCAGTTCGGCATCGGTCGGGAGCAGCTGAAGGACCCCTGCACCAACG
TGAACATCGGAGCCTGGGTCCTCGCAAACAACATCGCCAGGCACGGTGAGACCTGGCGCGCCGTCGGCGC
CTACAACGCTGCCACACCCAGCAAGCAAGTCGTCTATGTCGAGAAGGTGTGGCTCAACTCGATCAAGCTC
AAGAAGAACGGAACCCCCTGA
 Primer design