SecReT4
Protein ID: 124262921
T4SS name [ID]Tra_F [594]
Gene symboltraN
Locus tagMpe_B0381
StrainMethylibium petroleiphilum PM1
Repliconplasmid RPME01 [GenBank: NC_008826] [Browse all T4SS(s) in this replicon]
Location [Strand]333972..335666 [-]
Productconjugal transfer mating pair stabilization protein TraN
Component typeTraN_F
UniProt IDA2SNL7
KEGG IDmpt:Mpe_B0381
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 1.1e-65, Aligned region: 27..109
TraN [PF06986], Evalue: 1.1e-65, Aligned region: 143..325
TraN [PF06986], Evalue: 1.1e-65, Aligned region: 416..494
Protein Sequence: 564 a.a.     [Download]
>gi|124262921|ref|YP_001023391.1| conjugal transfer mating pair stabilization protein TraN [Methylibium petroleiphilum PM1]
MNILRWAAALLVSVGALLTAPQAQAGDCRYVGQTCVEPAEVRNINGTAIYQDCWKYEAKYECLKPNSVNY
CAALQSTSSCIQTSSSCIERAFDGSCMKERRTYRCDDPSKPPPANTVVLDDTYTVTEKLDTAQCDPYKDD
TTHCQVASHTCVEGAETRVINGKPIYKDCWRWEDEYTCVNPAPQNTCADLANNPACTKVSESCTDTDPKL
GCTLKDIQYSCITKPGSTQTVTDCSTKTACVGDTCWETGSPADTDFANAVIANEISREAATYQSKDGRLF
TGIGEECRDGWGGLRDCCDSSPGGKTNNNVLMKAGFSAATAVGKEAANIGSKYLFDFMYSGSEWATFVTN
SGSQVAVNASTGATGAFTSTSYTPSVELYGLGWSAGAAPSGATVLGNGFYFDPYSFAFAVAVQVIMSLTS
CEPSEQELGMHKGSGLTVYVGSYCSKKVLGACTQRSQAYCSFNSKLARIINEQGRKQLNKSWGDPKSPDC
SGFTVPEFSKIDFSKVDMSEFIDDVMSATDMPDPGKVSDVIADKMKGKTKNENYDALPKAPFGMVPVNQP
SPGP
 
Nucleotide Sequence: 1695 bp     [Download]
>gi|124262546|ref|NC_008826.1|:c335666-333972 Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence
ATGAACATCTTGCGCTGGGCGGCTGCCCTGCTCGTTTCAGTTGGTGCGCTGCTCACGGCGCCGCAGGCCC
AGGCCGGTGACTGCCGCTACGTGGGGCAGACCTGTGTCGAGCCCGCCGAGGTCCGCAACATCAACGGCAC
AGCGATCTACCAGGACTGCTGGAAGTACGAGGCAAAGTACGAGTGCCTCAAGCCCAACAGCGTGAACTAC
TGCGCCGCGCTGCAGAGCACTTCGAGTTGCATTCAGACCTCGAGCAGCTGCATCGAGCGCGCGTTCGACG
GATCGTGCATGAAGGAGCGCCGCACCTACCGGTGTGACGATCCGAGCAAGCCGCCGCCGGCCAACACCGT
CGTGCTGGACGACACATACACCGTCACGGAGAAGCTGGACACGGCTCAGTGCGATCCGTACAAGGACGAC
ACGACGCACTGCCAGGTCGCGTCGCACACCTGCGTCGAGGGCGCGGAAACGCGAGTGATCAACGGCAAGC
CGATCTACAAGGACTGCTGGAGGTGGGAGGACGAATACACCTGCGTCAACCCGGCGCCGCAGAACACCTG
CGCTGATCTGGCCAACAACCCGGCCTGCACGAAGGTGAGCGAAAGCTGCACCGACACGGATCCGAAGCTG
GGTTGCACGCTGAAAGACATCCAGTACAGCTGCATCACCAAGCCCGGATCCACCCAGACGGTGACGGACT
GCAGCACGAAGACTGCGTGCGTTGGCGACACCTGCTGGGAGACCGGCTCGCCAGCGGACACCGATTTCGC
GAACGCCGTGATCGCCAACGAGATCAGCCGCGAGGCAGCGACCTACCAGTCGAAAGACGGCAGGCTCTTC
ACCGGCATTGGTGAAGAGTGCCGGGACGGCTGGGGTGGGTTGCGCGACTGCTGCGATTCGAGCCCTGGCG
GCAAGACGAACAACAACGTCTTGATGAAGGCTGGCTTCAGCGCGGCGACAGCGGTCGGCAAGGAAGCTGC
AAACATTGGGTCCAAGTATCTCTTCGACTTCATGTACTCAGGCAGCGAGTGGGCGACGTTTGTGACGAAC
TCGGGCTCCCAGGTGGCGGTCAACGCTTCGACGGGTGCGACGGGGGCGTTCACCTCCACCAGCTACACCC
CGAGCGTGGAGCTCTATGGTCTCGGTTGGTCGGCAGGCGCAGCGCCGTCCGGTGCAACGGTGCTCGGAAA
CGGCTTCTACTTCGATCCGTACTCTTTCGCCTTCGCGGTCGCAGTCCAGGTCATCATGTCGCTGACCTCG
TGCGAGCCATCCGAACAGGAGCTGGGCATGCACAAGGGGTCGGGCCTGACGGTGTATGTCGGCTCGTACT
GCAGCAAGAAGGTGCTGGGCGCGTGCACGCAGCGCAGCCAAGCCTATTGCTCGTTCAACAGCAAGCTGGC
ACGAATCATCAACGAGCAAGGCCGCAAGCAGCTGAACAAGTCCTGGGGCGACCCAAAGAGCCCTGACTGC
TCGGGATTCACGGTGCCTGAGTTCTCGAAGATCGACTTCTCCAAGGTCGACATGTCGGAGTTCATCGACG
ACGTGATGAGCGCGACCGACATGCCTGACCCGGGCAAGGTCAGCGATGTCATCGCCGACAAGATGAAGGG
CAAGACGAAGAACGAGAACTACGATGCGTTGCCCAAGGCGCCGTTCGGCATGGTCCCGGTGAATCAGCCT
TCGCCTGGTCCTTGA
 Primer design