SecReT4
Protein ID: 124267564
T4SS name [ID]Tfc [709]
Gene symbol-
Locus tagMpe_A2378
StrainMethylibium petroleiphilum PM1
Repliconchromosome [GenBank: NC_008825] [Browse all T4SS(s) in this replicon]
Location [Strand]2543746..2544366 [+]
Producthypothetical protein
Component typeTfc4
UniProt IDA2SIE4
KEGG IDmpt:Mpe_A2378
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 206 a.a.     [Download]
>gi|124267564|ref|YP_001021568.1| hypothetical protein Mpe_A2378 [Methylibium petroleiphilum PM1]
MAAAVGTPGRERRPSRVAIRCASAALLLATGGWALAALAREVPPPAYQMAAHRADVPAAVLYAVALQESG
AMLRGRLIPWPWTLNVAGTPQRYATRAEACAGLRRALARTPANRIDAGLGQVNLGYHTHRYTQPCELLDP
YRNLAVAAEILREQHTPGEDWLLAIGRYHRPAGGAPAARYRRSVHRHLTRVLDPGVPVPTLQATTP
 
Nucleotide Sequence: 621 bp     [Download]
>gi|124265193|ref|NC_008825.1|:2543746-2544366 Methylibium petroleiphilum PM1 chromosome, complete genome
ATGGCAGCGGCAGTAGGTACGCCGGGCCGGGAGCGTCGGCCGTCCCGCGTCGCCATCCGCTGCGCCAGCG
CCGCGCTGCTGCTCGCCACCGGCGGCTGGGCGTTGGCCGCCCTGGCGCGGGAAGTGCCGCCGCCGGCCTA
TCAAATGGCGGCGCATCGTGCAGACGTGCCGGCGGCGGTGCTGTACGCGGTGGCCTTGCAGGAGAGCGGC
GCCATGCTGCGCGGGCGCCTGATCCCCTGGCCGTGGACGCTCAACGTCGCCGGCACACCGCAGCGCTACG
CCACCCGCGCCGAGGCCTGCGCGGGGCTGCGCCGGGCGCTCGCCCGCACGCCGGCCAATCGCATCGACGC
CGGCCTCGGCCAGGTCAATCTCGGCTACCACACGCATCGCTACACGCAGCCCTGCGAGCTGCTGGACCCG
TACCGCAACCTCGCCGTCGCTGCGGAAATCCTGCGCGAACAGCACACGCCGGGCGAGGACTGGCTGCTTG
CCATCGGCCGCTACCACCGGCCCGCCGGCGGGGCACCCGCGGCGCGATACCGGCGCAGTGTGCATCGGCA
CCTGACCCGCGTACTCGACCCCGGCGTTCCCGTTCCAACTCTCCAGGCCACCACGCCATGA
 Primer design