SecReT4
Protein ID: 124267567
T4SS name [ID]Tfc [709]
Gene symbol-
Locus tagMpe_A2381
StrainMethylibium petroleiphilum PM1
Repliconchromosome [GenBank: NC_008825] [Browse all T4SS(s) in this replicon]
Location [Strand]2547058..2547807 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDA2SIE7
KEGG IDmpt:Mpe_A2381
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 3e-72, Aligned region: 46..246
Protein Sequence: 249 a.a.     [Download]
>gi|124267567|ref|YP_001021571.1| hypothetical protein Mpe_A2381 [Methylibium petroleiphilum PM1]
MSDPAVAAQRQQQRQQGLIASLVTLPFRFFGVLCGALLLCILIECVGMHFFWPEQGWRHAQGMLHYELDQ
LSTHFTRSALVQEPGRTAHRLVEQGYDWLFVKSGLLDWIRDASAQASAGSHRPTKDFRYYIGLVYVNVES
YLIAAAYTTLVFLVRLLVLCLTLPLFLMAAFVGLVDGLVRRDIRRFGAGRESGFIYHRARASLIPLAVLP
WVTYLALPVSVNPLLILLPSAALLGVAVCIAAATFKKYL
 
Nucleotide Sequence: 750 bp     [Download]
>gi|124265193|ref|NC_008825.1|:2547058-2547807 Methylibium petroleiphilum PM1 chromosome, complete genome
ATGAGCGATCCGGCCGTCGCGGCACAGCGCCAGCAGCAACGACAGCAAGGCCTGATCGCCAGCCTGGTCA
CGCTGCCGTTCCGCTTCTTCGGCGTGCTGTGCGGCGCGCTGCTGCTGTGCATCCTGATCGAATGCGTCGG
CATGCACTTCTTCTGGCCCGAGCAGGGCTGGCGCCACGCGCAGGGCATGCTGCACTACGAGCTGGATCAG
CTTTCCACGCATTTCACCCGCAGCGCGCTGGTGCAGGAGCCGGGGCGCACCGCGCACCGGCTGGTCGAGC
AGGGCTACGACTGGCTGTTCGTGAAGAGCGGTCTGCTGGACTGGATACGCGACGCCTCGGCGCAGGCCAG
CGCCGGCAGCCATCGTCCGACCAAGGATTTCCGCTACTACATCGGCTTGGTCTATGTGAACGTGGAGAGC
TACCTGATCGCGGCGGCCTATACGACGCTGGTCTTCCTCGTGCGGCTGCTGGTGCTGTGCCTGACCCTGC
CGCTGTTCCTGATGGCCGCCTTCGTCGGGCTGGTCGACGGCCTGGTGCGCCGGGACATCCGCCGCTTCGG
CGCGGGACGCGAGTCGGGGTTCATCTATCACCGCGCCAGGGCCAGCTTGATCCCGCTGGCCGTACTACCG
TGGGTGACTTACCTGGCACTGCCGGTCAGCGTGAACCCGCTGCTGATCCTGCTGCCCAGCGCTGCATTGC
TCGGCGTGGCGGTGTGCATTGCGGCGGCGACGTTCAAGAAGTATCTCTAA
 Primer design