SecReT4
Protein ID: 124267572
T4SS name [ID]Tfc [709]
Gene symbol-
Locus tagMpe_A2386
StrainMethylibium petroleiphilum PM1
Repliconchromosome [GenBank: NC_008825] [Browse all T4SS(s) in this replicon]
Location [Strand]2552450..2552797 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDA2SIF2
KEGG IDmpt:Mpe_A2386
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 4.7e-31, Aligned region: 26..102
Protein Sequence: 115 a.a.     [Download]
>gi|124267572|ref|YP_001021576.1| hypothetical protein Mpe_A2386 [Methylibium petroleiphilum PM1]
MNTLTFRRLMGLLSVLLMASPAPVLASEVIEREQLAALARQLDLIDRLAEHAANTAPQERARYHFDYARL
RADLKRVRAGLQDYLVPQRAQPRDPVPLAGDYVRRDRTDDEEPSP
 
Nucleotide Sequence: 348 bp     [Download]
>gi|124265193|ref|NC_008825.1|:2552450-2552797 Methylibium petroleiphilum PM1 chromosome, complete genome
ATGAATACGCTGACGTTTCGCCGCTTAATGGGCCTGCTATCGGTCCTGCTCATGGCAAGCCCGGCGCCTG
TGCTAGCCAGCGAGGTCATCGAACGCGAACAGCTCGCCGCGCTCGCCCGCCAGCTCGACCTGATCGACCG
CCTCGCCGAGCACGCCGCCAATACCGCTCCGCAGGAACGCGCGCGCTACCACTTCGACTACGCCCGACTG
CGCGCAGACCTGAAGCGCGTTCGCGCCGGCCTGCAGGACTACCTCGTGCCCCAGCGCGCCCAGCCGCGCG
ATCCCGTCCCGCTGGCCGGCGATTACGTCCGCCGCGACCGCACCGACGACGAGGAGCCGTCGCCATGA
 Primer design