SecReT4
Protein ID: 124267575
T4SS name [ID]Tfc [709]
Gene symbol-
Locus tagMpe_A2389
StrainMethylibium petroleiphilum PM1
Repliconchromosome [GenBank: NC_008825] [Browse all T4SS(s) in this replicon]
Location [Strand]2553443..2553853 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDA2SIF5
KEGG IDmpt:Mpe_A2389
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 2.1e-49, Aligned region: 12..133
Protein Sequence: 136 a.a.     [Download]
>gi|124267575|ref|YP_001021579.1| hypothetical protein Mpe_A2389 [Methylibium petroleiphilum PM1]
MTVPSESPHDTLVTFLPHRLNRQPVVVRGLTADELWICAGLSAAAGFALGLPLAWLTHSIAMVPTLIVAG
IALGVFVGGGFLRAQKRGRPDTWLYRQLQWRLALRHPALAALLGGQRLITRSGYWTTRRNTNRGAP
 
Nucleotide Sequence: 411 bp     [Download]
>gi|124265193|ref|NC_008825.1|:2553443-2553853 Methylibium petroleiphilum PM1 chromosome, complete genome
ATGACTGTCCCTTCGGAGAGCCCGCACGACACGCTGGTGACCTTCCTGCCGCACCGACTGAATCGCCAGC
CGGTGGTCGTGCGCGGGCTGACCGCCGACGAGTTGTGGATCTGCGCCGGCCTGTCGGCCGCAGCCGGGTT
CGCGCTCGGCCTGCCCTTGGCCTGGCTCACGCACAGCATCGCCATGGTGCCCACGCTGATCGTCGCCGGC
ATCGCGCTGGGCGTCTTTGTCGGCGGAGGCTTCCTGCGCGCGCAGAAGCGCGGCCGGCCCGACACCTGGC
TGTACCGGCAGCTCCAATGGCGGTTGGCCCTGCGGCATCCGGCGCTGGCGGCGCTCCTGGGCGGGCAGCG
CCTCATCACCCGCTCGGGCTACTGGACTACCCGGCGCAACACCAATCGAGGGGCGCCATGA
 Primer design