SecReT4
Protein ID: 124267585
T4SS name [ID]Tfc [709]
Gene symbol-
Locus tagMpe_A2399
StrainMethylibium petroleiphilum PM1
Repliconchromosome [GenBank: NC_008825] [Browse all T4SS(s) in this replicon]
Location [Strand]2563193..2564599 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDA2SIG5
KEGG IDmpt:Mpe_A2399
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 468 a.a.     [Download]
>gi|124267585|ref|YP_001021589.1| hypothetical protein Mpe_A2399 [Methylibium petroleiphilum PM1]
MNASLPDFLRRAKSPLRATLLVAAITLVVGVAWAQTRIDPNGVNVSGSVIGDDVLYSIGGGRAVSMGGAG
NMQSIGVGVGWNSNLICGDMSITTTLQNQLNGITNGFQTIMSNVIQNATSAVASLPALIIQRADPGLYNL
LTNGILQARLDFDRSKMTCRAIANRMADMAGGQAGWDQLAEGMALRDAVSSTDAVSAIEQAESNKGNNGV
PWVGGGNAGGSGQSSIKVVGDVTRAGYNLLNGRNATDTSSIARSACGNRLTCQTWSSPQAAADWATRVLG
EREQRTCENCTKTQTTPGVGLTPMIQEEYETKLQALQELVTGARPTTLANLDAAGSSSLPITRGVIEALR
DEPDQDVLGRRLASEAALSSVLEKALLLQRTLLTGKKEPNVAANELAVQAVDQENSALEQEINNLKTELE
LRRTLAGNSAMAIIQRHSTRAAGSRGVFEGDTTRDRLREIQKPRSGTP
 
Nucleotide Sequence: 1407 bp     [Download]
>gi|124265193|ref|NC_008825.1|:2563193-2564599 Methylibium petroleiphilum PM1 chromosome, complete genome
ATGAACGCCTCCCTCCCTGACTTTCTGCGCCGCGCGAAGTCGCCCCTGCGGGCCACGCTGCTCGTGGCGG
CCATCACGCTGGTCGTCGGCGTCGCCTGGGCGCAGACCCGCATCGACCCCAATGGCGTGAACGTCAGCGG
CAGCGTGATCGGCGACGACGTGCTCTACAGCATCGGCGGCGGCCGGGCCGTGTCGATGGGTGGTGCCGGC
AACATGCAGAGCATCGGCGTCGGCGTCGGCTGGAACAGCAACCTGATCTGCGGCGACATGAGCATCACCA
CGACGCTGCAGAACCAGCTCAACGGCATCACCAACGGCTTCCAGACGATCATGAGCAACGTGATCCAGAA
TGCCACCAGCGCCGTGGCCTCGCTGCCGGCCCTGATCATCCAGCGCGCCGACCCGGGTCTCTACAACCTG
CTGACCAACGGCATCCTCCAGGCGCGCCTGGACTTCGACCGCTCGAAGATGACCTGCCGGGCCATCGCCA
ATCGGATGGCGGACATGGCCGGCGGCCAAGCCGGCTGGGACCAGCTCGCCGAGGGGATGGCGCTGCGGGA
TGCGGTCAGCAGCACCGATGCCGTCTCCGCCATCGAGCAGGCCGAGTCCAACAAAGGGAACAACGGCGTG
CCCTGGGTCGGCGGCGGCAACGCGGGCGGCTCCGGCCAGAGTTCGATCAAGGTGGTCGGCGACGTGACGC
GCGCGGGCTACAACCTGCTCAACGGGCGCAACGCCACCGATACCTCGTCGATCGCGCGCAGCGCCTGCGG
CAACCGCCTGACCTGCCAAACCTGGTCCTCGCCCCAGGCGGCCGCCGACTGGGCGACCCGCGTGTTGGGC
GAACGCGAGCAACGCACCTGCGAAAACTGCACGAAGACCCAGACCACGCCTGGCGTCGGGCTCACGCCAA
TGATCCAGGAGGAGTACGAGACCAAGCTGCAGGCGCTGCAGGAACTGGTGACGGGCGCCCGGCCGACGAC
GTTGGCCAATCTCGACGCAGCCGGCAGCAGCTCGCTGCCGATCACCCGCGGCGTGATCGAGGCCCTGCGT
GACGAACCCGACCAGGACGTGCTGGGCCGGCGCCTCGCGTCCGAGGCTGCGCTGTCCAGCGTGCTGGAGA
AGGCCCTGCTGCTGCAACGCACGTTGCTGACCGGCAAGAAGGAGCCGAACGTCGCTGCCAACGAGCTGGC
CGTGCAGGCGGTCGACCAGGAGAACAGCGCGCTGGAGCAGGAGATCAACAACCTCAAGACCGAGCTGGAA
CTGCGGCGCACGCTGGCCGGCAACTCGGCGATGGCGATCATCCAGCGCCACAGCACCCGCGCTGCCGGCT
CGCGCGGCGTCTTCGAGGGCGACACCACGCGCGACCGTCTGCGGGAAATCCAGAAGCCGCGGAGCGGTAC
GCCATGA
 Primer design