SecReT4
Protein ID: 126697941
T4SS name [ID]Tra_Tn [667]
Gene symbol-
Locus tagCD630_03710
StrainClostridium difficile 630
Repliconchromosome [GenBank: NC_009089] [Browse all T4SS(s) in this replicon]
Location [Strand]440599..441510 [-]
Productconjugative transposon protein
Component typeOrf13_Tn
UniProt IDQ18DA6
KEGG IDcdf:CD0371
PDB IDNA
Domain hit(s) vs Pfam TpcC [PF12642], Evalue: 1.4e-59, Aligned region: 77..301
Protein Sequence: 303 a.a.     [Download]
>gi|126697941|ref|YP_001086838.1| conjugative transposon protein [Clostridium difficile 630]
MFKKNKKQTETIKEPKEKKVRTVKVGTHKKTVIALWAVLIASVSFGVYKNFTAIDQHTTHEKEIIELRLQ
DTNGIENFVKNFAKSYYTWNNSKEAIEARTQAISGYLTKELQDLNVDTIRTDIPTSSTVTDVIVWHIEQS
GTDTFSATYEVDQQIKEGEQTSNVKATYTVKVHVDADGDMVIVQNPTLAPAIEKSDYEPKTPEADASVDA
DTVNDATAFLETFFKLYPTATEKELAYYVSGNVLEPIGRDYLYSELVNPVFTKDGDNVKVKVAVKFLDNQ
TKATLVSQYELVLHKDSNWKIVG
 
Nucleotide Sequence: 912 bp     [Download]
>gi|126697566|ref|NC_009089.1|:c441510-440599 Clostridium difficile 630, complete genome
ATGTTTAAGAAGAATAAGAAACAGACAGAAACTATTAAAGAACCAAAAGAAAAAAAGGTGCGTACTGTCA
AGGTAGGCACACATAAGAAAACCGTGATTGCGTTGTGGGCGGTGCTTATCGCAAGCGTGAGCTTTGGGGT
GTATAAGAATTTTACCGCTATCGACCAGCACACGACCCATGAAAAAGAAATCATAGAGCTTCGCTTGCAG
GACACCAACGGGATAGAAAATTTCGTGAAGAATTTTGCGAAATCCTATTACACATGGAATAACAGCAAAG
AAGCTATCGAAGCAAGGACGCAGGCAATCAGCGGTTATCTGACAAAGGAATTGCAGGACTTGAATGTAGA
TACAATCAGAACGGATATACCGACCAGCTCCACAGTTACAGATGTGATTGTGTGGCATATCGAGCAATCG
GGAACGGACACTTTTTCTGCTACCTACGAAGTAGATCAGCAGATAAAAGAGGGAGAACAGACAAGCAATG
TGAAAGCAACCTATACTGTAAAAGTCCATGTGGACGCTGACGGGGATATGGTAATCGTTCAGAACCCTAC
CCTTGCACCAGCAATCGAAAAATCGGACTATGAGCCTAAGACACCAGAAGCAGACGCAAGTGTAGACGCT
GATACTGTAAACGACGCTACCGCATTTTTGGAAACATTCTTTAAACTGTACCCGACAGCCACAGAAAAAG
AGCTTGCTTACTATGTATCGGGAAATGTGCTTGAACCTATCGGCAGGGACTATCTGTATTCTGAATTGGT
AAACCCAGTATTTACAAAGGACGGGGACAATGTGAAAGTCAAGGTGGCTGTGAAATTCCTTGATAATCAG
ACAAAGGCAACTTTAGTTTCGCAGTATGAGCTTGTGCTACATAAAGATAGTAACTGGAAGATTGTAGGAT
AA
 Primer design