SecReT4
Protein ID: 126697942
T4SS name [ID]Tra_Tn [667]
Gene symbol-
Locus tagCD630_03720
StrainClostridium difficile 630
Repliconchromosome [GenBank: NC_009089] [Browse all T4SS(s) in this replicon]
Location [Strand]441526..442533 [-]
Productcell wall hydrolase
Component typeOrf14_Tn
UniProt IDQ18DB2
KEGG IDcdf:CD0372
PDB IDNA
Domain hit(s) vs Pfam Lysozyme_like [PF13702], Evalue: 3.4e-61, Aligned region: 47..204
NLPC_P60 [PF00877], Evalue: 1.2e-29, Aligned region: 226..331
SLT [PF01464], Evalue: 2e-05, Aligned region: 101..154
Protein Sequence: 335 a.a.     [Download]
>gi|126697942|ref|YP_001086839.1| cell wall hydrolase [Clostridium difficile 630]
MKLKHIALIGSLFPILFSLVLFFGVLISADSDDENSNFSSGITGMNLSAEVLKHQPMVEKYARENGISEY
VNVLLAIIQVESGGTAEDVMQSSESLGLPPNSLDTESSIKQGCKYFASLLSSSKNQGIDDLNVAIQSYNY
GGGYVGYVAGKGKKHTFNLAESFAREKSGGKKVTYTNPIAVAKNGGWRWNYGNMFYVELVNQYLTVPQVS
GELAQKVMNEALKYQGWKYVYGGSNPNTSFDCSGLTQWCYGKAGISLPRTAQAQYDATQHLPLSQAKAGD
LVFFHSTYNAGSYVTHVGIYVGNNQMYHAGDPIGYADLSSSYWQQHLIGAGRVKQ
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|126697566|ref|NC_009089.1|:c442533-441526 Clostridium difficile 630, complete genome
ATGAAACTGAAACATATCGCTCTTATTGGCAGTCTGTTTCCTATCCTCTTTTCTCTGGTGCTGTTCTTTG
GGGTATTGATTAGTGCGGACAGCGACGACGAGAACAGCAACTTTTCTTCTGGCATTACGGGTATGAACCT
ATCCGCAGAAGTTTTGAAACATCAGCCTATGGTAGAAAAATACGCCAGAGAAAACGGTATCTCCGAGTAT
GTCAATGTGCTACTGGCTATCATTCAAGTAGAAAGTGGCGGTACGGCAGAAGATGTTATGCAGAGTTCGG
AAAGTCTAGGACTACCGCCTAATTCCTTAGATACGGAAAGCTCAATCAAGCAGGGGTGTAAGTATTTTGC
GTCCCTGCTTTCTTCCAGCAAAAATCAAGGTATCGACGACTTGAATGTAGCGATACAGTCCTATAACTAT
GGCGGTGGCTATGTGGGATATGTGGCAGGAAAAGGAAAGAAACACACTTTTAACCTTGCAGAGAGCTTCG
CCCGTGAGAAATCGGGTGGAAAGAAAGTAACCTACACCAACCCGATAGCTGTTGCGAAGAATGGGGGCTG
GCGTTGGAACTATGGAAATATGTTCTATGTGGAATTAGTTAATCAGTATTTAACTGTTCCGCAGGTATCG
GGAGAACTGGCACAAAAGGTAATGAATGAAGCGTTGAAATATCAAGGCTGGAAATATGTGTATGGGGGCA
GTAACCCGAATACTTCCTTTGACTGTTCGGGATTGACGCAATGGTGTTATGGAAAAGCTGGTATCTCTTT
ACCGAGAACCGCACAGGCACAGTATGACGCAACCCAACATCTGCCACTCTCGCAGGCAAAGGCTGGGGAC
TTGGTGTTTTTCCATTCCACTTATAACGCTGGTTCGTATGTAACGCACGTCGGTATCTATGTGGGAAATA
ACCAGATGTACCATGCAGGCGACCCGATAGGATATGCAGACCTAAGCAGTAGTTACTGGCAACAGCACTT
AATCGGTGCAGGACGAGTTAAACAATAG
 Primer design