SecReT4
Protein ID: 126697944
T4SS name [ID]Tra_Tn [667]
Gene symbol-
Locus tagCD630_03740
StrainClostridium difficile 630
Repliconchromosome [GenBank: NC_009089] [Browse all T4SS(s) in this replicon]
Location [Strand]444737..447187 [-]
ProductATPase
Component typeOrf16_Tn
UniProt IDQ18DB0
KEGG IDcdf:CD0374
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.3e-32, Aligned region: 467..762
Protein Sequence: 816 a.a.     [Download]
>gi|126697944|ref|YP_001086841.1| ATPase [Clostridium difficile 630]
MFPIKYIDNNLVWNKDNEVFAYYELIPYNYSFLSAEQKFIVHDSFRQLIAQSREGKIHALQIATESSIRS
MQEQSKKLVTGKLREVAVQKIDEQTEALVSMIGDNQVDYRFFLGFKLMVTEEQLNLKNIKKSAWLTFKEF
LHEVNHTLMNDFVSMPNDEINRYMKMEKLLENKISRRFKVRRLEIHDFGYLMEHLYGRDGIAYEDYEYQL
PKKNYKKETLIKYYDLIRPTRCVIEESQRYLRLEHEDKESYVSYFTVNAIVGELDFPSSEIFYFQQQQFT
FPVDTSMNVEIVENRKALTTVRNKKKELKDLDNHAYQAGSETSSNVVDALDSVDELETDLDQSKESMYKL
SYVIRVSAPDLDELKRRCDEVKDFYDDLNVKLVRPAGDMLGLHSEFLPASKRYINDYVQYVKSDFLAGLG
FGATQQLGENTGIYIGYSVDTGRNVYLQPSLASQGVKGTVTNALASAFVGSLGGGKSFCNNLLVYYAVLF
GGQALLLDPKSERGNWKETLPEIAHEINIVNLTSDKGNAGLLDPFVIMKNVKDAESLAIDILTFLTGISS
RDGEKFPVLRKAVRSVTQSANRGLLYVIEELRKEDTAISRNIADHIDSFTDYDFAHLLFSDGTVENAISL
DNQLNIIQVADLVLPDKDTTFEEYTTIELLSVSMLIVISTFALDFIHSDRSIFKIVDLDEAWAFLNVAQG
ETLSNKLVRAGRAMQAGVYFVTQSSGDVSKESLKNNIGLKFAFRSTDINEIKQTLEFFGIDKDDENNQKR
LRDLENGQCLLQDLYGRVGVVQIHPVFEELLHAFDTRPPVQRNEVE
 
Nucleotide Sequence: 2451 bp     [Download]
>gi|126697566|ref|NC_009089.1|:c447187-444737 Clostridium difficile 630, complete genome
ATGTTCCCGATAAAATATATTGACAATAACCTTGTCTGGAACAAGGACAATGAGGTGTTCGCTTACTATG
AGCTGATACCGTATAATTATTCTTTCTTATCCGCAGAGCAGAAATTTATCGTGCATGACAGTTTTCGACA
GCTTATCGCACAGTCCCGTGAGGGTAAAATTCATGCCTTGCAGATTGCCACAGAAAGCTCAATCCGAAGT
ATGCAGGAACAGTCAAAGAAGCTGGTAACGGGCAAACTTCGTGAGGTGGCAGTCCAGAAAATAGACGAAC
AGACCGAAGCGTTAGTATCAATGATTGGGGATAATCAAGTGGACTACCGCTTTTTTCTTGGCTTTAAGCT
CATGGTTACGGAAGAACAGCTCAATCTGAAGAACATCAAAAAATCGGCGTGGCTGACATTCAAGGAATTT
CTCCATGAAGTGAACCACACGCTGATGAATGATTTTGTTTCCATGCCGAATGATGAAATCAACCGTTACA
TGAAAATGGAAAAGTTACTGGAAAATAAAATCTCCCGTCGCTTTAAGGTGCGTCGCTTGGAAATCCATGA
TTTTGGGTATCTCATGGAACATCTTTACGGCAGGGACGGTATCGCCTATGAAGATTATGAGTACCAGCTA
CCAAAGAAGAATTATAAGAAAGAAACGCTGATAAAATACTACGACCTTATCCGTCCGACAAGATGTGTGA
TTGAGGAAAGCCAGCGGTATTTACGATTGGAACATGAGGACAAGGAAAGTTATGTGTCCTACTTTACCGT
CAATGCGATTGTCGGGGAGCTTGATTTTCCGTCCTCTGAAATCTTCTATTTCCAGCAACAGCAGTTCACA
TTCCCCGTCGATACTTCTATGAATGTAGAAATCGTGGAAAATCGCAAAGCATTAACGACCGTTCGCAACA
AGAAAAAGGAATTGAAAGACCTTGACAATCACGCCTATCAAGCAGGAAGTGAAACCAGCTCAAATGTGGT
GGACGCTTTAGACAGCGTAGACGAGCTGGAAACAGACTTAGACCAGAGCAAAGAAAGTATGTATAAGTTA
AGCTACGTCATACGGGTGTCTGCCCCCGATCTTGACGAGCTGAAACGCCGTTGTGATGAAGTCAAGGACT
TTTACGACGACCTCAATGTAAAGCTGGTGCGTCCTGCTGGCGATATGTTGGGGCTTCATTCTGAATTTTT
ACCAGCCAGCAAGCGATATATCAATGACTATGTGCAGTATGTAAAATCAGACTTTTTGGCAGGGCTTGGT
TTTGGAGCGACACAGCAGTTAGGGGAAAATACGGGTATCTATATTGGCTATTCCGTCGATACTGGAAGAA
ATGTGTACCTGCAACCGTCTTTAGCTTCGCAGGGAGTGAAAGGTACAGTTACCAACGCCCTTGCTTCTGC
TTTTGTCGGTTCGCTTGGCGGTGGAAAGTCATTCTGCAACAATCTACTTGTATATTATGCGGTGCTGTTT
GGCGGTCAAGCACTTCTGTTAGACCCTAAAAGTGAGCGTGGCAACTGGAAAGAAACACTTCCAGAAATCG
CCCATGAAATCAATATTGTAAACCTTACCAGCGATAAAGGCAATGCAGGACTTCTTGACCCGTTCGTGAT
TATGAAGAATGTGAAAGACGCTGAAAGTCTGGCAATCGACATCTTAACATTCCTTACGGGTATTTCCTCT
AGGGACGGCGAAAAATTCCCCGTACTTCGTAAGGCGGTTCGTTCCGTTACCCAGAGTGCAAATAGAGGAC
TGTTATACGTTATTGAGGAATTGAGAAAAGAAGATACTGCTATCTCACGCAATATCGCAGACCATATCGA
CAGCTTCACGGACTACGACTTTGCACATCTGCTGTTTTCAGACGGAACGGTAGAAAATGCTATCAGTCTG
GATAACCAGCTCAACATCATTCAAGTAGCAGACCTTGTATTGCCAGATAAAGATACCACCTTTGAGGAAT
ACACGACCATTGAATTGTTGTCGGTGTCTATGCTGATTGTGATTAGTACCTTTGCCCTTGATTTTATCCA
TTCGGACAGAAGTATTTTTAAGATTGTAGATTTGGACGAAGCGTGGGCGTTCTTAAATGTGGCACAAGGA
GAAACCTTATCAAATAAGCTGGTTCGTGCTGGACGAGCTATGCAGGCAGGCGTTTATTTCGTTACACAAT
CATCTGGCGACGTATCAAAAGAAAGTCTGAAAAATAATATCGGCTTGAAATTTGCCTTTCGCTCTACGGA
CATTAACGAGATAAAACAGACCTTAGAGTTTTTCGGTATTGACAAGGACGACGAAAACAACCAGAAACGG
CTTCGTGATTTGGAGAACGGACAATGCTTATTGCAGGACTTATACGGGCGTGTCGGTGTGGTACAGATAC
ACCCCGTCTTTGAAGAACTGCTACACGCCTTTGATACCAGACCGCCCGTACAGAGAAATGAGGTGGAGTG
A
 Primer design