SecReT4
Protein ID: 126697945
T4SS name [ID]Tra_Tn [667]
Gene symbol-
Locus tagCD630_03750
StrainClostridium difficile 630
Repliconchromosome [GenBank: NC_009089] [Browse all T4SS(s) in this replicon]
Location [Strand]447165..447563 [-]
Productconjugative transposon protein
Component typeOrf17_Tn
UniProt IDQ18DB7
KEGG IDcdf:CD0375
PDB IDNA
Domain hit(s) vs Pfam TcpE [PF12648], Evalue: 6.6e-34, Aligned region: 6..107
Protein Sequence: 132 a.a.     [Download]
>gi|126697945|ref|YP_001086842.1| conjugative transposon protein [Clostridium difficile 630]
MKKIKSYTGIWNVEKVLYAINDFNLPFPVTFTQITWFVITEFIIILFGDIPPLSMIEGAFLKYFGIPVAL
TWFMSQKTFDGKKPYSFLKSQITYALRPKITYAGKAVKLHKQTLNETITAVRSVNYVPDKIY
 
Nucleotide Sequence: 399 bp     [Download]
>gi|126697566|ref|NC_009089.1|:c447563-447165 Clostridium difficile 630, complete genome
TTGAAAAAGATTAAATCTTATACGGGTATCTGGAACGTGGAAAAAGTCTTGTATGCAATCAATGACTTTA
ACTTACCCTTTCCCGTTACTTTTACACAGATTACATGGTTTGTGATTACGGAATTTATCATCATTCTGTT
TGGGGATATACCCCCACTTTCCATGATTGAGGGAGCATTTCTCAAATATTTCGGTATTCCCGTTGCTCTC
ACTTGGTTTATGTCGCAGAAAACCTTTGACGGAAAGAAGCCGTACAGCTTTTTGAAATCGCAGATAACTT
ATGCGTTGCGACCGAAAATCACTTATGCAGGAAAAGCCGTAAAACTGCATAAGCAGACCTTGAATGAAAC
AATCACGGCAGTAAGGAGTGTGAACTATGTTCCCGATAAAATATATTGA
 Primer design