SecReT4
Protein ID: 126697952
T4SS name [ID]Tra_Tn [667]
Gene symbol-
Locus tagCD630_03830
StrainClostridium difficile 630
Repliconchromosome [GenBank: NC_009089] [Browse all T4SS(s) in this replicon]
Location [Strand]451221..452591 [-]
Productcell-division FtsK/SpoIIIE-family protein8
Component typeOrf21_Tn
UniProt IDQ18DC0
KEGG IDcdf:CD0383
PDB IDNA
Domain hit(s) vs Pfam FtsK_SpoIIIE [PF01580], Evalue: 3.9e-31, Aligned region: 192..368
AAA_10 [PF12846], Evalue: 1.7e-06, Aligned region: 225..262
Protein Sequence: 456 a.a.     [Download]
>gi|126697952|ref|YP_001086849.1| cell-division FtsK/SpoIIIE-family protein8 [Clostridium difficile 630]
MGRLNYKGKRIRASDKHLVYHFSIGTLLFVFVAVLLLLNIKQFMRTDWEHFSLLENGLTLSTYNFITILI
ATGVCALVAFLYYRFCYDNFKKLLHRQKLARMVLENKWYEADTVQDSGFFTDLQSRSREKIVWFPKIYYQ
MEKGLLHIRCEITLGKYQDQLLRLEDKLESGLYCELTDKTLHDGYIEYTLLYDMIANRITIDEVRAENGC
LKLMKNLVWEYDALPHALIAGGTGGGKTYFLLTLIEALLHTNAVLYILDPKNADLADLGTVMGNVYHTKE
EMIDCVNAFYEGMVQRSEEMKQHPNYKTGENYAYLGLPPCFLIFDEYVAFFEMLGTKESVSLLSQLKKIV
MLGRQAGYFLIVACQRPDAKYFSDGIRDNFNFRVGLGRISELGYGMLFGSDVKKQFFQKRIKGRGYCDVG
TSVISEFYTPLVPKGHDFLQTIGRLAQDRQDLPEKE
 
Nucleotide Sequence: 1371 bp     [Download]
>gi|126697566|ref|NC_009089.1|:c452591-451221 Clostridium difficile 630, complete genome
ATGGGACGATTAAACTATAAGGGAAAGCGTATCAGAGCCAGCGACAAGCACCTTGTTTATCACTTTTCCA
TAGGGACGCTTCTGTTTGTGTTCGTGGCAGTTCTCCTGCTATTGAATATAAAACAGTTCATGCGTACCGA
TTGGGAACATTTCAGCTTGTTAGAAAACGGCTTGACGCTTTCCACTTACAACTTCATAACGATACTGATA
GCGACTGGTGTTTGTGCATTGGTCGCTTTTCTGTATTACCGTTTCTGTTACGACAATTTCAAGAAGCTCC
TGCACCGTCAAAAGCTGGCACGAATGGTACTGGAAAATAAGTGGTATGAAGCCGATACCGTACAAGACAG
CGGTTTTTTTACTGACCTGCAAAGCAGATCAAGGGAAAAAATCGTCTGGTTTCCGAAGATTTATTATCAA
ATGGAAAAAGGACTGCTTCATATCCGCTGTGAAATTACATTAGGGAAATATCAAGACCAGCTTTTACGGT
TAGAGGATAAATTGGAAAGTGGCTTGTATTGCGAGCTGACCGACAAGACCTTACATGACGGCTATATCGA
ATATACCCTGCTTTATGATATGATAGCGAACCGCATTACCATTGATGAAGTAAGGGCAGAAAACGGCTGT
CTTAAATTGATGAAAAATCTTGTCTGGGAATATGACGCACTTCCTCATGCTCTGATTGCTGGTGGGACTG
GTGGCGGTAAAACCTATTTTCTGCTGACGCTCATTGAAGCCTTACTGCATACCAACGCTGTCCTTTATAT
CTTAGACCCGAAGAACGCTGACCTTGCGGACTTGGGAACAGTTATGGGAAATGTGTATCACACCAAAGAA
GAAATGATTGATTGCGTCAATGCCTTTTATGAGGGCATGGTACAGCGAAGCGAGGAAATGAAGCAACACC
CGAACTATAAGACGGGCGAAAATTACGCCTATCTGGGACTGCCACCCTGCTTTCTTATCTTTGATGAATA
TGTAGCGTTTTTTGAAATGCTGGGAACAAAGGAAAGCGTAAGCCTACTTAGCCAGTTAAAGAAAATCGTT
ATGTTAGGGCGACAAGCAGGATATTTTCTTATCGTTGCCTGCCAGCGTCCAGACGCAAAGTATTTCTCGG
ACGGTATCAGAGATAACTTCAATTTCCGTGTGGGATTGGGGCGTATCAGCGAATTAGGTTATGGTATGCT
GTTTGGTTCAGATGTGAAAAAGCAGTTTTTCCAGAAGCGTATCAAGGGGCGTGGCTACTGTGATGTAGGA
ACAAGCGTTATCAGCGAATTTTACACGCCTTTAGTCCCAAAAGGACATGATTTTTTACAAACTATCGGCA
GGCTTGCACAAGACCGACAAGACCTGCCAGAGAAAGAATGA
 Primer design