SecReT4
Protein ID: 126698074
T4SS name [ID]Tra_Tn [668]
Gene symbol-
Locus tagCD630_04980
StrainClostridium difficile 630
Repliconchromosome [GenBank: NC_009089] [Browse all T4SS(s) in this replicon]
Location [Strand]586451..587836 [+]
Productcell-division FtsK/SpoIIIE-family protein Tn5397, CTn3-Orf21
Component typeOrf21_Tn
UniProt IDQ188U2
KEGG IDcdf:CD0498
PDB IDNA
Domain hit(s) vs Pfam FtsK_SpoIIIE [PF01580], Evalue: 7.4e-38, Aligned region: 187..365
AAA_10 [PF12846], Evalue: 6.3e-07, Aligned region: 222..259
DUF87 [PF01935], Evalue: 3.9e-06, Aligned region: 222..343
Protein Sequence: 461 a.a.     [Download]
>gi|126698074|ref|YP_001086971.1| cell-division FtsK/SpoIIIE-family protein Tn5397, CTn3-Orf21 [Clostridium difficile 630]
MKQRGKRIRPSDKDLVFHFTIASLLPVFLLVVGLFHVKTIQQINWQDLDLLQVDKIDIPYLVISFSVAIL
VCLLGAFIFRRYKYDMFKQLQHRQKLAKMILENKWYESEQVKTDGFFKDSTSRTKEKITYFPKMYYRLKD
GLISIRVEIMLGKYQDQLLHLEKKLESGLYCELTDKELKDSYVEYTLLYDTIANRLSIDEVQAKDGKLRL
MTNVWWEYDKLPHMLIAGGTGGGKTYFILTLIEALLHTNSKLTILDPKNADLADLGSVMGNVYYRKDDML
SCIDRFYDEMMKRSEVMKKMENYKTGENYAYLGLPAHFLIFDEYVAFMEMLGTKENTAVLNKLKQIVMLG
RQAGFFLILACQRPDAKYLGDGIRDQFNFRVALGRMSEMGYGMMFGSDVQKDFFLKQIKGRGYVDVGTSV
ISEFYTPLVPKGHDFLEEIKRLSHSKQDTQATCEAEVAGVD
 
Nucleotide Sequence: 1386 bp     [Download]
>gi|126697566|ref|NC_009089.1|:586451-587836 Clostridium difficile 630, complete genome
ATGAAACAGCGTGGTAAAAGGATTCGCCCATCGGATAAAGATTTAGTCTTTCATTTTACGATTGCTTCAC
TTCTGCCTGTTTTCCTGCTGGTTGTCGGACTGTTTCATGTGAAGACAATCCAGCAGATCAACTGGCAGGA
TTTAGACCTACTACAAGTAGATAAGATTGACATTCCCTATTTAGTTATCAGTTTCAGTGTCGCAATTCTT
GTTTGCTTGTTAGGTGCTTTTATATTCAGAAGATACAAGTACGATATGTTCAAACAGCTACAGCACCGTC
AAAAGCTGGCGAAGATGATTCTTGAAAACAAGTGGTATGAATCAGAACAAGTCAAAACTGATGGTTTCTT
CAAGGATAGTACCAGTCGGACAAAGGAAAAGATAACCTACTTTCCCAAAATGTATTATCGCCTTAAAGAT
GGCTTGATAAGTATACGTGTTGAAATCATGCTGGGGAAATATCAAGACCAGCTCTTACACTTGGAAAAGA
AGCTGGAAAGTGGCTTGTACTGTGAGCTGACCGACAAGGAGCTAAAGGATTCTTATGTAGAATATACCTT
GCTCTATGACACCATAGCCAATCGACTTTCCATTGATGAAGTACAAGCCAAAGATGGCAAGTTACGCTTA
ATGACGAATGTCTGGTGGGAATATGACAAACTCCCTCACATGCTGATTGCTGGGGGAACTGGTGGCGGTA
AGACCTACTTCATTTTGACACTGATTGAAGCTCTACTTCATACCAATTCAAAACTGACTATCCTTGACCC
AAAGAATGCTGATCTTGCAGACTTAGGCTCTGTGATGGGAAATGTCTACTACAGGAAAGACGATATGCTT
TCCTGCATTGACCGTTTCTATGATGAAATGATGAAACGCAGTGAAGTTATGAAAAAGATGGAAAACTACA
AGACAGGCGAAAACTATGCTTACTTAGGATTGCCAGCTCATTTTCTTATCTTTGATGAATATGTGGCTTT
TATGGAAATGCTGGGAACAAAGGAAAATACCGCAGTGCTTAACAAGCTCAAACAGATTGTTATGTTAGGT
CGTCAAGCTGGATTCTTTCTGATACTGGCTTGTCAAAGACCCGACGCAAAATATTTAGGCGACGGAATCA
GAGACCAGTTTAATTTTAGAGTGGCTTTAGGTCGTATGTCTGAAATGGGCTATGGCATGATGTTTGGAAG
TGACGTACAGAAAGACTTTTTCCTAAAGCAGATTAAAGGACGTGGTTATGTTGATGTTGGAACAAGTGTC
ATCTCTGAATTTTATACTCCCCTTGTACCTAAAGGACATGATTTCTTAGAGGAAATAAAAAGGTTATCCC
ACAGCAAACAGGACACGCAGGCGACGTGCGAAGCGGAAGTCGCAGGTGTGGACTAA
 Primer design